DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and dpr20

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:211 Identity:47/211 - (22%)
Similarity:79/211 - (37%) Gaps:58/211 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    47 NMMVRKGDTAVLRCYL----------------EDGASKGAWLNRSSIIFAGGDKWSVDPRVSIST 95
            |:.|:.|.:..|.|.:                ::|...|   |...::..|...::.|.|..:..
  Fly   278 NLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNG---NALDLLTVGMHTYTGDKRYKMEF 339

Human    96 LNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVP-------------PKIYDISND 147
            ....::.|:|.||...|:..|.|.:.| |.||.:|::|.|..|             .|.|:|  |
  Fly   340 QYPNNWRLKITNVKKDDEAIYECQIST-HPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEI--D 401

Human   148 MTVNEGTNVTLTCLATGKPEPS--ISWRH-------------ISPSAKPFENG--QYLDIYGITR 195
            .|:.      |:|:.......|  :.|:|             :|...:..|:|  ..|.|..|::
  Fly   402 STLQ------LSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISK 460

Human   196 DQAGEYECSAENDVSF 211
            ..:|.|.||.....:|
  Fly   461 TDSGNYTCSISEFQNF 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 24/103 (23%)
IGc2 152..210 CDD:197706 15/74 (20%)
Ig_3 225..301 CDD:372822
dpr20NP_612066.1 IG_like 278..365 CDD:214653 18/89 (20%)
Ig 279..378 CDD:299845 23/102 (23%)
Ig 400..471 CDD:299845 18/78 (23%)
IG_like 402..480 CDD:214653 17/81 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.