DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and CG13506

DIOPT Version :10

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_611666.2 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:300 Identity:66/300 - (22%)
Similarity:119/300 - (39%) Gaps:31/300 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    41 PWAAVDNMMV--RKGDTAVLRCYLEDGASKGA--WLNRSSIIFAGGDKWSVDPRVSISTLNKRDY 101
            |:..|.::.|  :.||..:|.|...:.....|  |. ::.||.|.|.. .:..||.....|    
  Fly    70 PYFDVTDLRVEAKPGDDVILNCDARNFQLSNAVVWY-KNRIIIANGQN-PISQRVQCMLNN---- 128

Human   102 SLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISND-------MTVNEGTNVTLT 159
            |:.::||...|...|.|.:    .|:.::.|..::|..::..:.:|       .|..:|.:..|.
  Fly   129 SILLRNVSPEDSDDYYCEI----LPQRVRQHTALRVGARLSILCDDRDITDRSQTFRQGDHHKLE 189

Human   160 CLATGKPEPSISWR----HISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVV 220
            |........:|.|.    :..||:...:||..: :..:....||:|:|.|::....|....|.:.
  Fly   190 CRTYLPDNATIKWSFNDLNGQPSSVDNQNGVII-LDNVDEKNAGDYQCLADDGSRHPPHGTVHID 253

Human   221 VNFAPTIQEIKSGTVT-PGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGII---IQNFSTRSI 281
            |.::|.:...:....| .|.:..:.|.....|.....:.|..|.|....:..:   :.|...|:.
  Fly   254 VQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTT 318

Human   282 LTVTNVTQEHFGNYTCVAANKLGTTNASLPLN-PPSTAQY 320
            |.|..||....|.|.|...|.:|:....:.:: .|.|.|:
  Fly   319 LIVREVTDSDLGEYLCQVENAIGSNEVKVHVSYNPETPQF 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 22/91 (24%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 68..72 CDD:409353 1/5 (20%)
Ig strand E 101..105 CDD:409353 1/3 (33%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig_3 138..207 CDD:464046 16/79 (20%)
IG_like 231..312 CDD:214653 18/84 (21%)
Ig strand B 241..245 CDD:409353 0/3 (0%)
Ig strand C 254..258 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 1/3 (33%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
CG13506NP_611666.2 Ig_3 69..146 CDD:464046 21/81 (26%)
Ig_3 173..238 CDD:464046 14/65 (22%)
Ig 258..349 CDD:472250 19/90 (21%)
Ig strand B 275..279 CDD:409353 0/3 (0%)
Ig strand C 288..292 CDD:409353 0/3 (0%)
Ig strand E 317..321 CDD:409353 1/3 (33%)
Ig strand F 331..336 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.