DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and wrapper

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:232 Identity:63/232 - (27%)
Similarity:99/232 - (42%) Gaps:25/232 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   102 SLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTVNE-GTNVTLTCLATGK 165
            |||:.||..:|.|.|.|.:.:.......|..:.||:.|::....:|:|... |....:.|.|.|.
  Fly    95 SLQVANVQSSDTGDYYCEMNSDSGHVVQQH
AIEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGV 159

Human   166 PEPSISWR----HISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPT 226
            |:|.|:||    .|.|.:.. .|.|.|.:...:|:|||..||.|.|.|..|.|..|.:.|.|:|.
  Fly   160 PQPVITWRLNGNVIQPQSNT-GNRQSLILEIKSRNQAGLIECVASNGVGEPAVANVYLHVL
FSPE 223

Human   227 IQEIKSGTVTP-GRSGLIRCEGAGVPPPAFEWY-------------KGEKKLFNGQQGIIIQNF- 276
            :...:....|. |....:.|.....|....:|:             ..|.:|   |....:.:: 
  Fly   224 VSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESEL---QTNRSVDHYV 285

Human   277 -STRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPL 312
             :.|.:|.|.:|.....|.|.|.|:|::...:.|:.|
  Fly   286 NAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVEL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 10/32 (31%)
IGc2 152..210 CDD:197706 22/62 (35%)
Ig_3 225..301 CDD:372822 17/91 (19%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 9/28 (32%)
IG_like 41..118 CDD:214653 9/22 (41%)
IG_like 145..218 CDD:214653 26/73 (36%)
Ig 147..219 CDD:299845 26/72 (36%)
I-set 224..323 CDD:254352 19/102 (19%)
IGc2 236..314 CDD:197706 16/80 (20%)
FN3 339..431 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.