DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and Lac

DIOPT Version :10

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:339 Identity:105/339 - (30%)
Similarity:155/339 - (45%) Gaps:59/339 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    35 GQSVDF----PWAAVDNMMVRKGDTAVLRCYLEDGASKGAWLNRSSIIFAGGDKWSV--DPRVSI 93
            |.:|:|    .:|...|::..|.|            |...:|:..|.:.....::|:  ||    
  Fly    43 GGTVEFDCSVQYAKEYNVLFLKTD------------SDPVFLSTGSTLVIKDSRFSLRYDP---- 91

Human    94 STLNKRDYSLQIQNVDVTDDGPYTCSV--QTQHTPRTMQVHLTVQVPPKIYDISNDMTV-NEGTN 155
               |...|.|||:::..||.|.|||.|  .|.|.. :.:|.|:|:.||.|.|.|....| :||:.
  Fly    92 ---NSSTYKLQIKDIQETDAGTYTCQVVISTVHKV-SAEVKLSVRRPPVISDNSTQSVVASEGSE 152

Human   156 VTLTCLATGKPEPSISWRHISPSAKPFENGQY----LDIYGITRDQAGEYECSAENDVSFPDVRK 216
            |.:.|.|:|.|.|:|:||..:.:..|.::..|    |.|..:.::..|.|.|.|:|.||..|.|.
  Fly   153 VQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRN 217

Human   217 VKVVVNFAPTIQEIKSGTVTPGRSGL-------IRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQ 274
            :.|.|.|||.|      ||...|.|.       :.|.....||||..|.|.:.:|.|.|. ..|.
  Fly   218 INVEVEFAPVI------TVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQH-YSIS 275

Human   275 NFSTR-----SILTVTNVTQEHFGNYTCVAANKLGTTNAS-------LPLNPPSTAQYGITGSAD 327
            :|:|.     |.|.|..|.:..:|:|.|.|.|:.|...|.       :|:.||:..|..|.|:.|
  Fly   276 HFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVCPPACGQAYIAGAED 340

Human   328 VLFSCWYLVLTLSS 341
            |..:.:.||..|::
  Fly   341 VSATSFALVGILAA 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 25/91 (27%)
Ig strand B 56..60 CDD:409353 0/3 (0%)
Ig strand C 68..72 CDD:409353 0/3 (0%)
Ig strand E 101..105 CDD:409353 2/3 (67%)
Ig strand F 115..120 CDD:409353 3/4 (75%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig_3 138..207 CDD:464046 25/73 (34%)
IG_like 231..312 CDD:214653 28/99 (28%)
Ig strand B 241..245 CDD:409353 1/10 (10%)
Ig strand C 254..258 CDD:409353 1/3 (33%)
Ig strand E 280..284 CDD:409353 2/3 (67%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
LacNP_523713.2 IG_like 36..131 CDD:214653 29/107 (27%)
Ig strand B 46..50 CDD:409381 2/3 (67%)
Ig strand C 60..63 CDD:409381 0/2 (0%)
Ig strand E 96..100 CDD:409381 2/3 (67%)
Ig strand F 110..115 CDD:409381 3/4 (75%)
Ig strand G 124..127 CDD:409381 0/2 (0%)
Ig_3 134..208 CDD:464046 25/73 (34%)
Ig 227..318 CDD:472250 29/97 (30%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.