DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and Dscam1

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:235 Identity:64/235 - (27%)
Similarity:95/235 - (40%) Gaps:28/235 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   102 SLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKP 166
            :|.|::..|.|.|.|.|.|.......:::..|||..|..........||:.|.....||..||.|
  Fly   310 TLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTV
TAPLSAKIDPPTQTVDFGRPAVFTCQYTGNP 374

Human   167 EPSISWR-------HISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDV-RKVKVVVNF 223
            ..::||.       |..|         .|.|..:.::..|.|:|...||....:. .::|:...|
  Fly   375 IKTVSWMKDGKAIGHSEP---------VLRIESVKKEDKGMYQCFVRNDQESAEASAELKLGGRF 430

Human   224 APTI--QEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQ----NFSTRSIL 282
            .|.:  |..:..|:.||.|..::|...|.|.|...|....||:.|..:..:.|    |....|.|
  Fly   431 DPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVTVNGDVVSYL 495

Human   283 TVTNVTQEHFGNYTCVAANKLGTTNASLPLNPPSTAQYGI 322
            .:|:|.....|.|.|:|.:|:|....|..||     .||:
  Fly   496 NITSVHANDGGLYKCIAKSKVGVAEHSAKLN-----VYGL 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 9/32 (28%)
IGc2 152..210 CDD:197706 17/64 (27%)
Ig_3 225..301 CDD:372822 24/81 (30%)
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653 9/32 (28%)
Ig 269..340 CDD:143165 8/29 (28%)
IG_like 353..425 CDD:214653 19/80 (24%)
IGc2 361..413 CDD:197706 15/60 (25%)
I-set 433..527 CDD:254352 28/98 (29%)
IGc2 446..517 CDD:197706 22/70 (31%)
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.