DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and dpr19

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:343 Identity:74/343 - (21%)
Similarity:129/343 - (37%) Gaps:67/343 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    48 MMVRKGDTAVLRCYLE-DGASKGAWLNRS--SIIFAGGDKWSVDPRVSIS-TLNKRDYSLQIQNV 108
            ::.:||..|:|.|.:: :..:..:|:.|.  .::..|....|.|.|..:. |.:...:||:|:.|
  Fly    50 VIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAV 114

Human   109 DVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISN--DMTVNEGTNVTLTC---LATGKPEP 168
            ...|.|.|.|.:...   .|..:.:.:::...:.:||:  ::.::|.:.:.|.|   .||..| .
  Fly   115 REEDRGFYECQLSIY---PTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENP-A 175

Human   169 SISWRHISPSAK-PFENGQYLDIYGITRDQAGE-YECSAENDVSFPDVRKVKVVVNFAPTIQEIK 231
            .:.|.|.|.... ..:.|..:...|.:..|:|: |..|..|.             :.|....|..
  Fly   176 FVFWYHDSKMINYDSQGGFVVTSIGQSNPQSGQFYRSSPANK-------------SRATMPMESS 227

Human   232 SGTVTP--GRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGN 294
            :|.:..  |.|..|:...|.||       .....:....|...:.|.|. |:|||..|...|.||
  Fly   228 NGVLNSLLGSSDAIKAPAANVP-------SSTPYMTQQHQSAYLLNPSV-SVLTVKQVNFRHAGN 284

Human   295 YTCVAANKLGTTNASLPLNPPSTAQY------------------------GITGSADVLFSCWYL 335
            |||..:|....:.....|....||..                        |:.|::.|..:...|
  Fly   285 YTCAPSNARPASITVHVLRGEKTAAMQHANRSILDTETNGNGTFGLITLGGLNGTSGVTLAGGIL 349

Human   336 VLTLSSFTSIFYLKNAIL 353
            .     |:.:|.|..|::
  Fly   350 Y-----FSGLFLLMGAVV 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 21/90 (23%)
IGc2 152..210 CDD:197706 16/62 (26%)
Ig_3 225..301 CDD:372822 22/77 (29%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 20/76 (26%)
IGc2 55..125 CDD:197706 18/69 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.