DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and DIP-zeta

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:305 Identity:95/305 - (31%)
Similarity:144/305 - (47%) Gaps:29/305 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    45 VDNMMVRKGDTAVLRCYLED-GASKGAWLN--RSSIIFAGGDKWSVDPRVSISTLNKRD----YS 102
            ::|:.|..|....|.|.::: |:.|.||::  :|:|:.......:.:||:|: |.:|.|    :.
  Fly   119 IENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISV-THDKHDRHRTWY 182

Human   103 LQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYD--ISNDMTVNEGTNVTLTCLATGK 165
            |.|.||...|.|.|.|.:.|. |.:|...:|.|.|||.|.|  .|:|:.|.||.|::|.|.|:|.
  Fly   183 LHINNVHEEDRGRYMCQINTV-TAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGS 246

Human   166 PEPSISWR-----HISPSAKPFEN---GQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVN 222
            |.|.|.|:     .|:.:.....|   |..|:|..|:|...|.|.|.|.|.|.....:::||.|:
  Fly   247 PRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVD 311

Human   223 FAPTIQEIKSGTVTP-GRSGLIRCEGAGVPPPAFEWYKGEKKL------FNGQQGIIIQNFSTRS 280
            |.|.:.........| |.:..|.|.....|.....|.:||..:      :..:..:.:..:.|..
  Fly   312 FPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHM 376

Human   281 ILTVTNVTQEHFGNYTCVAANKLGTTNASLPL---NPPSTAQYGI 322
            .||:.||:....|.|.|||.|..|.|:..:.|   .||:||..||
  Fly   377 KLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGI 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 29/94 (31%)
IGc2 152..210 CDD:197706 23/65 (35%)
Ig_3 225..301 CDD:372822 19/82 (23%)
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/97 (31%)
Ig 130..200 CDD:143165 22/70 (31%)
I-set 226..310 CDD:254352 29/83 (35%)
IGc2 233..298 CDD:197706 23/64 (36%)
Ig 313..410 CDD:299845 23/96 (24%)
IG_like 325..410 CDD:214653 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143438
Domainoid 1 1.000 45 1.000 Domainoid score I12195
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6406
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.