DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and DIP-iota

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:317 Identity:98/317 - (30%)
Similarity:144/317 - (45%) Gaps:34/317 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    16 WLAAVLLSLCCLLPSCLPAGQSVDFPWAA-VDNMMVRKGDTAVLRCYLEDGAS-KGAWL--NRSS 76
            ||  :||...|...:......:.|..::. ::|..|..|..|:|.|.:.|..| |.|||  :..:
  Fly     9 WL--LLLQSVCFSQASFSELNNSDPKFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQT 71

Human    77 IIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQV-HLTVQVPPK 140
            |:.......:.:.|:|||....|.:.|:|::|..:|.|.|.|.:.|.  |...|: :|.|.|||.
  Fly    72 ILSIQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINTD--PMKSQMGYLDVVVPPD 134

Human   141 I--YDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKPF------------ENGQYLDIY 191
            |  |..|.|:..:.|.||||||.|||.|.|:|:||.  ..|.|.            ..||.|.::
  Fly   135 IVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRR--EEATPILISDDGDREVFSVEGQNLTLW 197

Human   192 GITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTI----QEIKSGTVTPGRSGLIRCEGAGVPP 252
            .:.|...|.|.|.|.|.|.....::|.:||||||||    ..|..|.   |:...:.|.....|.
  Fly   198 QVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGL---GQKLTLECITESQPA 259

Human   253 PAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVT--NVTQEHFGNYTCVAANKLGTTN 307
            ....|.:..:.|..|....:..:...|.::.:|  .:|:..||.|.|.|.|.:|.|:
  Fly   260 SVNFWLRDSQLLQGGSYESVSVDHVFRIVMRITLRPITKRDFGEYICRAKNAMGQTD 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 29/91 (32%)
IGc2 152..210 CDD:197706 26/69 (38%)
Ig_3 225..301 CDD:372822 19/81 (23%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 28/87 (32%)
Ig 39..122 CDD:299845 27/84 (32%)
Ig 132..213 CDD:299845 31/82 (38%)
IG_like 141..227 CDD:214653 30/87 (34%)
IG_like 239..322 CDD:214653 19/81 (23%)
IGc2 245..313 CDD:197706 15/67 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143459
Domainoid 1 1.000 59 1.000 Domainoid score I10656
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.