DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and DIP-theta

DIOPT Version :10

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:288 Identity:88/288 - (30%)
Similarity:138/288 - (47%) Gaps:24/288 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    45 VDNMMVRKGDTAVLRCYLED-GASKGAWL--NRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQ 106
            :.|:.|.....|||:|.::: ...|.|||  :..:|:.......:.:.|:||:...||.:.|:|:
  Fly   136 LQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWILRIR 200

Human   107 NVDVTDDGPYTCSVQTQHTPRTMQV-HLTVQVPPKI--YDISNDMTVNEGTNVTLTCLATGKPEP 168
            :|..:|.|.|.|.:.|.  |...|| :|.|.|||.|  |..|.||.:.||:||||.|.|||.|.|
  Fly   201 DVKESDKGWYMCQINTD--PMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAATGSPTP 263

Human   169 SISWRHISPSAKPFE--------NGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAP 225
            :|:||.......|..        ||.:|.|..:.|...|.|.|.|.|.:.....::|.::|:|.|
  Fly   264 TITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPP 328

Human   226 TI---QEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGI---IIQNFSTRSILTV 284
            .|   .::....:|  ::..:.|:....|.....|.|.:..:..|::.:   ....:.....||:
  Fly   329 MIWIQNQLVGAALT--QNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKITMRLTI 391

Human   285 TNVTQEHFGNYTCVAANKLGTTNASLPL 312
            ..|..:.||.|.|||.|.||.|:.::.|
  Fly   392 YEVDIQDFGAYRCVAKNSLGDTDGAIKL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 28/91 (31%)
Ig strand B 56..60 CDD:409353 3/3 (100%)
Ig strand C 68..72 CDD:409353 2/3 (67%)
Ig strand E 101..105 CDD:409353 1/3 (33%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig_3 138..207 CDD:464046 32/78 (41%)
IG_like 231..312 CDD:214653 19/83 (23%)
Ig strand B 241..245 CDD:409353 0/3 (0%)
Ig strand C 254..258 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 1/3 (33%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 29/94 (31%)
Ig strand B 147..151 CDD:409353 3/3 (100%)
Ig strand C 160..164 CDD:409353 2/3 (67%)
Ig strand E 195..199 CDD:409353 1/3 (33%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 1/2 (50%)
Ig 232..324 CDD:472250 33/91 (36%)
Ig strand B 251..255 CDD:409275 3/3 (100%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 17/82 (21%)

Return to query results.
Submit another query.