DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and bdl

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:363 Identity:74/363 - (20%)
Similarity:129/363 - (35%) Gaps:87/363 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    47 NMMVRKGDTAVLRCYLEDGA-SKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDY-----SLQI 105
            |..:|:|.||...|.::... |:.:|.....::            ..:..|.:|.|     ||.|
  Fly   159 NQTIREGQTAFFHCVMKHPENSQASWYKDGVLL------------QEVQDLVRRFYMGPDGSLSI 211

Human   106 QNVDVTDDGPYTCSVQTQHTP-RTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTC-LATGKPEP 168
            ....::|.|.|.|.|:..... :|.:..|.:|...|:.....::.:..|....|.| .....|..
  Fly   212 DPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLK 276

Human   169 SISWRHISPSAKPFENGQYLDIYG----------------ITRDQAGEYECSAENDVSFPDVRKV 217
            ::.|.         ::|...|.|.                :..:.||.|.|:..||:.......|
  Fly   277 NLRWE---------KDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPV 332

Human   218 KVVVNFAPTIQEIKSGTVTP--------GRSGLIRCEGA---GVPPPAFEWYKGEKKLFNGQQGI 271
            ..|:...|.|     .:|||        |.:..:.||..   |...|:..|  |.|   :||. :
  Fly   333 ISVIVLRPPI-----FSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIW--GRK---DGQP-L 386

Human   272 IIQNFS-TRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPL---NPPSTAQYGITGSA------ 326
            ....|| :...||:|.:.:...|.|.|.|.|:..|..|...|   |....|.|.:|.::      
  Fly   387 PADRFSLSGGNLTITGLVEGDRGIYECSATNEAATITAEAELMIENIAPRAPYNLTANSTETCIT 451

Human   327 ----------DVLFSCWYLVLTLSSFTSIFYLKNAILQ 354
                      ::.::.||.::....:.::..|...:::
  Fly   452 IRWQPGYLRPNLEYTVWYRLMEAPEWRTLRVLDKKVME 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 21/94 (22%)
IGc2 152..210 CDD:197706 14/74 (19%)
Ig_3 225..301 CDD:372822 24/87 (28%)
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 21/94 (22%)
Ig 157..242 CDD:299845 21/94 (22%)
Ig_2 252..337 CDD:290606 16/93 (17%)
IG_like 260..327 CDD:214653 14/75 (19%)
I-set 341..428 CDD:254352 26/97 (27%)
IGc2 356..419 CDD:197706 20/68 (29%)
FN3 435..524 CDD:238020 6/55 (11%)
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.