DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and dpr2

DIOPT Version :10

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:306 Identity:73/306 - (23%)
Similarity:116/306 - (37%) Gaps:68/306 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    40 FPWAAVDNMMVRKGDTAVLRCYLED-GASKGAWLNRSS--IIFAGGDKWSVDPRVS-ISTLNKRD 100
            |.:....|:..|.|.||.:.|.::: |....:|:.:..  |:.||...::.|.|.. :.|.:.:|
  Fly   108 FDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKD 172

Human   101 YSLQIQNVDVTDDGPYTCSVQTQHTPR-TMQVHLTVQV-PPKIYDI---SNDMTVNEGTNVTLTC 160
            ::|.::.....|.|.|.|.|.|:  |: :|...|.|.| ||....|   ..|:.|..|::|||||
  Fly   173 WTLHVKYAQPRDSGIYECQVNTE--PKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTC 235

Human   161 LATGKPEPSISWRHISP--------SAKPF---ENGQYLDIYGITRD------------------ 196
            ..   .:|:.|.:.|.|        ...||   .|...:|:..|:.:                  
  Fly   236 HV---KQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQL 297

Human   197 -QAGEYEC---SAENDVSFPDVRKVKVVVNF----APTIQEIKSGTVTPG--RSGLIRCEGAGVP 251
             ..|.|.|   :||         ...||||.    :|...:......|.|  ||..:....|.|.
  Fly   298 LDTGNYTCMPTTAE---------AASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLLAMVA 353

Human   252 PPAFEWYKGEKKLFNGQQGIIIQNFSTRSI------LTVTNVTQEH 291
            .....|..|.:::.:........|.||..|      ..:|:..:||
  Fly   354 SSVVRWLIGGQRIGSNSCHDSCSNLSTLHINYCNLRAKITSHLKEH 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 25/92 (27%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 68..72 CDD:409353 0/3 (0%)
Ig strand E 101..105 CDD:409353 1/3 (33%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 1/2 (50%)
Ig_3 138..207 CDD:464046 24/104 (23%)
IG_like 231..312 CDD:214653 15/69 (22%)
Ig strand B 241..245 CDD:409353 0/3 (0%)
Ig strand C 254..258 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 1/9 (11%)
Ig strand F 294..299 CDD:409353
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 25/94 (27%)
Ig strand A' 116..118 CDD:409355 0/1 (0%)
Ig strand B 122..130 CDD:409355 3/7 (43%)
CDR1 130..136 CDD:409355 1/5 (20%)
FR2 137..151 CDD:409355 2/13 (15%)
Ig strand C 137..143 CDD:409355 1/5 (20%)
Ig strand C' 149..153 CDD:409355 1/3 (33%)
CDR2 153..162 CDD:409355 1/8 (13%)
Ig strand D 162..167 CDD:409355 0/4 (0%)
FR3 163..192 CDD:409355 7/28 (25%)
Ig strand E 172..178 CDD:409355 2/5 (40%)
Ig strand F 186..192 CDD:409355 3/5 (60%)
IG_like 220..306 CDD:214653 19/88 (22%)
Ig strand B 231..235 CDD:409353 3/3 (100%)
Ig strand C 261..265 CDD:409353 2/3 (67%)
Ig strand E 289..292 CDD:409353 0/2 (0%)
Ig strand F 302..307 CDD:409353 2/4 (50%)
Ig strand G 310..313 CDD:409353 2/11 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.