DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and dpr3

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:309 Identity:63/309 - (20%)
Similarity:115/309 - (37%) Gaps:91/309 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    40 FPWAAVDNMMVRKGDT-AVLRCYLEDGASKG-AWLNRSS--IIFAGGDKWSVDPRVSIS-TLNKR 99
            |.:....|:..|.|.| |:::|.::....|. :|:.:..  |:..|...::.|.|..:: :.:.|
  Fly   238 FDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSR 302

Human   100 DYSLQIQNVDVTDDGPYTCSVQTQHTPR---TMQVHLTVQVPPKIYDISN---DMTVNEGTNVTL 158
            :::|.::.....|.|.|.|.|.|:  |:   ..|::: :::.|....:.:   |:....|:.:.|
  Fly   303 EWTLHVKAPLAKDSGIYECQVNTE--PKMSMAFQLNI-IEISPDAKAVISGPPDLHFKAGSAIIL 364

Human   159 TCLATGKPEPSIS------WRHISPSAKPF--ENGQYLDIYGITRDQAGEYECSAENDVSFPDVR 215
            .||.   .:||:.      |........||  ::||.....|......|..|.::.||:    :.
  Fly   365 NCLV---QQPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDI----MS 422

Human   216 KVKVVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRS 280
            :|.:.:.||..|                          |.|...|:               :.:|
  Fly   423 EVDLQMEFATRI--------------------------AMESQLGD---------------TLKS 446

Human   281 ILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNPPSTAQYGITGSADVL 329
            .|.::|......|||||                .|:||     .||.||
  Fly   447 RLRISNAQTTDTGNYTC----------------QPTTA-----SSASVL 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 22/95 (23%)
IGc2 152..210 CDD:197706 16/65 (25%)
Ig_3 225..301 CDD:372822 12/75 (16%)
dpr3NP_001014459.2 Ig 243..330 CDD:299845 21/88 (24%)
IG_like 243..329 CDD:214653 21/87 (24%)
Ig 350..464 CDD:299845 32/177 (18%)
IG_like <441..477 CDD:214653 16/70 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.