DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and DIP-beta

DIOPT Version :10

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:358 Identity:93/358 - (25%)
Similarity:150/358 - (41%) Gaps:68/358 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     9 GACC--SNQWLAAVLLSLCCLLPSCLPAGQS----------VDFPWAAVDNMMVRKGDTAVLRCY 61
            |:.|  :.:|...:||    ||.:|:....|          .||. ..::|:.:.:|..|...|.
  Fly    61 GSGCGPAIRWQLLLLL----LLGNCIDLTVSNKISSVGAFEPDFV-IPLENVTIAQGRDATFTCV 120

Human    62 LE---------DGAS---KGAWL--NRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTD 112
            :.         ||:|   |.||:  :..:|:.......:.:.|:|:...:...::|.|:.|.:.|
  Fly   121 VNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMED 185

Human   113 DGPYTCSVQTQHTPRTMQ-VHLTVQVPPKIY--DISNDMTVNEGTNVTLTCLATGKPEPSISWR- 173
            .|.|.|.|.|.  |..|| ..|.|.:||.|.  :.|.||.|.||.:..|.|.|.|.|:|.|:|| 
  Fly   186 AGKYMCQVNTD--PMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRR 248

Human   174 ------------HISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPT 226
                        |....|:..| |:.|.:..|||.:.|.|.|.|.|.|.....:::|:.|:|.|.
  Fly   249 EDGREIIARNGSHQKTKAQSVE-GEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPL 312

Human   227 IQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQN------------FSTR 279
            :|........|..:.:.........|.|..:::.|    ||:  :||..            ::..
  Fly   313 VQVPNQLVGAPVLTDVTLICNVEASPKAINYWQRE----NGE--MIIAGDRYALTEKENNMYAIE 371

Human   280 SILTVTNVTQEHFGNYTCVAANKLGTTNASLPL 312
            .||.:..:....||.|.|::.|.:|.|..::.|
  Fly   372 MILHIKRLQSSDFGGYKCISKNSIGDTEGTIRL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 26/102 (25%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 68..72 CDD:409353 2/3 (67%)
Ig strand E 101..105 CDD:409353 1/3 (33%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 2/3 (67%)
Ig_3 138..207 CDD:464046 30/83 (36%)
IG_like 231..312 CDD:214653 17/92 (18%)
Ig strand B 241..245 CDD:409353 0/3 (0%)
Ig strand C 254..258 CDD:409353 1/3 (33%)
Ig strand E 280..284 CDD:409353 2/3 (67%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 29/113 (26%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 2/3 (67%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 32/96 (33%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 17/84 (20%)
Ig strand B 328..332 CDD:409353 0/3 (0%)
Ig strand C 341..346 CDD:409353 0/4 (0%)
Ig strand E 365..376 CDD:409353 2/10 (20%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.