DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and dpr8

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:248 Identity:59/248 - (23%)
Similarity:99/248 - (39%) Gaps:48/248 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    13 SNQWLAAVLLSLCCLLPSC-----------------LPAGQSVDFPWAAVDNMMVRKGDTAVLRC 60
            |..|:  :.|.:.|||..|                 .|......|......|:....|.|..|.|
  Fly     2 STHWI--IFLGILCLLAGCTDGASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTC 64

Human    61 YLED-GASKGAWLNRSSI--IFAGGDKWSVDPRV-SISTLNKRDYSLQIQNVDVTDDGPYTCSVQ 121
            .::: |....:|:....|  :..|...::.|.|. ::.:.:..|::|:|:.....|.|.|.|.:.
  Fly    65 RVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQIS 129

Human   122 TQHTPRTMQVHLTVQVPPKIYDI--SNDMTVNEGTNVTLTCLATGKPE--PSISWRH-------I 175
            |. .|....|:|.:..|  :.||  ..::.:|.|:.:.|||:....||  |::.|.|       .
  Fly   130 TT-PPIGHSVYLNIVEP--VTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFD 191

Human   176 SPS---AKPFENG-----QYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVV 220
            ||.   :...|.|     :.|....||:| :|.|.|:..|  :.|...:|.:|
  Fly   192 SPRGGISLVTEKGVLTTSRLLVQKAITQD-SGLYTCTPSN--ANPTSVRVHIV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 22/91 (24%)
IGc2 152..210 CDD:197706 21/74 (28%)
Ig_3 225..301 CDD:372822
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 18/79 (23%)
V-set 52..143 CDD:284989 21/91 (23%)
IG_like 153..238 CDD:214653 23/87 (26%)
ig 153..232 CDD:278476 22/81 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.