DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and DIP-kappa

DIOPT Version :10

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:327 Identity:91/327 - (27%)
Similarity:149/327 - (45%) Gaps:58/327 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    34 AGQSVDFPWAA--VDNMMVRKGDTAVLRCYLED-GASKGAW--LNRSSIIFAGGDKWSVDPRVSI 93
            |.:..|||..|  :.|:.|..|..|::.|.:|: ...|.||  ::..:|:....:..|.:.|:|:
  Fly    67 AQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISL 131

Human    94 STLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYD--ISNDMTVNEGTNV 156
            :..:.|.:.|.|:.|:.||.|.|.|.|.|. ..|:.:.:|.|.|||.|.:  .||||.|.||.|:
  Fly   132 TYNDHRSWYLHIKEVEETDRGWYMCQVNTD-PMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNI 195

Human   157 TLTCLATGKPEPSISWR------------HISPSAKPFENGQYLDIYGITRDQAGEYECSAENDV 209
            :|.|.|.|.|||.:.||            |::     ..:|:.|.|..::|.....|.|.|.|.|
  Fly   196 SLVCKARGYPEPYVMWRREDGEEMLIGGEHVN-----VVDGELLHITKVSRLHMAAYLCVASNGV 255

Human   210 SFPDVRKVKVVVNFAPTI---QEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGI 271
            .....::|.:.|.|.|.:   .:::...:  |:..::.|.....|.....|        ..::|.
  Fly   256 PPSISKRVHLRVQFPPMLSIPNQLEGAYL--GQDVILECHTEAYPASINYW--------TTERGD 310

Human   272 IIQNFSTR------SILTVTNVTQ-----------EHFGNYTCVAANKLGTTNASLPLN---PPS 316
            :|.:.::|      :..||:..|:           ..||.|.|||.|.||.|:.::.|:   .|:
  Fly   311 MIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDEMPTPT 375

Human   317 TA 318
            ||
  Fly   376 TA 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 26/90 (29%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 68..72 CDD:409353 3/5 (60%)
Ig strand E 101..105 CDD:409353 1/3 (33%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig_3 138..207 CDD:464046 28/82 (34%)
IG_like 231..312 CDD:214653 20/97 (21%)
Ig strand B 241..245 CDD:409353 0/3 (0%)
Ig strand C 254..258 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 0/3 (0%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 27/92 (29%)
Ig strand B 91..95 CDD:409353 1/3 (33%)
Ig strand C 104..108 CDD:409353 2/3 (67%)
Ig strand E 139..143 CDD:409353 1/3 (33%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 0/2 (0%)
Ig 176..267 CDD:472250 30/95 (32%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 0/3 (0%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 20/95 (21%)
Ig strand B 288..292 CDD:409353 0/3 (0%)
Ig strand C 301..305 CDD:409353 1/11 (9%)
Ig strand E 330..340 CDD:409353 1/9 (11%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.