DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and DIP-alpha

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:317 Identity:87/317 - (27%)
Similarity:142/317 - (44%) Gaps:57/317 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    44 AVDNMMVRKGDTAVLRCYLED-GASKGAWLN---------RSSIIFAGGDKWSVDPRVSISTLNK 98
            ::.|:.|..|..|...|::.. |..:..||.         ..::|       :.:|||::|.|::
  Fly    47 SISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVI-------THNPRVTVSHLDQ 104

Human    99 RDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQV-HLTVQVPPKIY--DISNDMTVNEGTNVTLTC 160
            ..::|.|:.|...|.|.|.|.:.|.  |...|: .|.|.:||...  |.|:|:.|.||::|.|||
  Fly   105 NTWNLHIKAVSEEDRGGYMCQLNTD--PMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTC 167

Human   161 LATGKPEPSISWRH----------------ISPSAKPFENGQYLDIYGITRDQAGEYECSAENDV 209
            .|.|.|||.::||.                ::||.:    |:.|.:..|:|::.|.|.|.|.|.|
  Fly   168 RARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFR----GEVLKLSKISRNEMGSYLCIASNGV 228

Human   210 SFPDV-RKVKVVVNFAPTIQEIKSGTVTP-GRSGLIRCEGAGVPPPAFEWYK--GEKKLFNGQQG 270
            . |.| :::.:.::|.|.||........| |....|.|.....|.....|.|  ||..:.:|:..
  Fly   229 P-PSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYH 292

Human   271 IIIQN---FSTRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNPPSTAQYGITG 324
            :...:   :.|:..:.|....::..|:|.|:|.|.||..::|:.|       |.|.|
  Fly   293 VQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRL-------YEIPG 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 25/98 (26%)
IGc2 152..210 CDD:197706 24/73 (33%)
Ig_3 225..301 CDD:372822 19/81 (23%)
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 21/86 (24%)
Ig 51..131 CDD:299845 21/88 (24%)
I-set 144..240 CDD:254352 32/100 (32%)
IGc2 159..228 CDD:197706 24/72 (33%)
Ig 244..337 CDD:299845 23/92 (25%)
I-set 244..337 CDD:254352 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12195
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.