DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and dpr7

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:338 Identity:62/338 - (18%)
Similarity:109/338 - (32%) Gaps:128/338 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    43 AAVDNMMVRKGDTAVLRCYLED-GASKGAWLNRSSI--------IFAGGDKWSVDPRVSISTLNK 98
            |.||       :.|:|||.::: |....:|:.:..:        .:.|..::||     |.....
  Fly    63 AVVD-------EIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSV-----IHPPGS 115

Human    99 RDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLAT 163
            .|:.|:|......|.|.|.|.|.|:               |||             |:.: ||  
  Fly   116 EDWDLKIDYAQPRDSGVYECQVNTE---------------PKI-------------NLAI-CL-- 149

Human   164 GKPEPSISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVS-------FPDVRKVKVVV 221
                                                  :..|:||..       |.|.:..:..:
  Fly   150 --------------------------------------QVIADNDFQDLKTKKRFYDTKSARAKI 176

Human   222 NFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKL-FNGQQGIII-----QNFSTRS 280
            ..:..|...:..|:.      :.| ...:..|:..||.|...: |:..:|.|.     .:..|.|
  Fly   177 LGSTEIHVKRDSTIA------LAC-SVNIHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTS 234

Human   281 ILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNPPSTAQYGITG--------SADVLFSCWYLVL 337
            .|.:|..:....||||||       .|.::   |.|...:.:||        |:.:....:..::
  Fly   235 RLMLTRASLRDSGNYTCV-------PNGAI---PASVRVHVLTGEQPAAMQTSSAIRIRAFTAMI 289

Human   338 TLSSFTSIFYLKN 350
            |:.|...:.|:.:
  Fly   290 TIISTKVLLYISS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 19/96 (20%)
IGc2 152..210 CDD:197706 6/57 (11%)
Ig_3 225..301 CDD:372822 20/81 (25%)
dpr7NP_001096850.2 V-set 56..145 CDD:284989 25/121 (21%)
IG_like 58..140 CDD:214653 21/88 (24%)
IG_like 179..265 CDD:214653 23/102 (23%)
Ig 187..257 CDD:299845 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.