DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and dpr7

DIOPT Version :10

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:338 Identity:62/338 - (18%)
Similarity:109/338 - (32%) Gaps:128/338 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    43 AAVDNMMVRKGDTAVLRCYLED-GASKGAWLNRSSI--------IFAGGDKWSVDPRVSISTLNK 98
            |.||       :.|:|||.::: |....:|:.:..:        .:.|..::||     |.....
  Fly    63 AVVD-------EIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSV-----IHPPGS 115

Human    99 RDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLAT 163
            .|:.|:|......|.|.|.|.|.|:               |||             |:.: ||  
  Fly   116 EDWDLKIDYAQPRDSGVYECQVNTE---------------PKI-------------NLAI-CL-- 149

Human   164 GKPEPSISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVS-------FPDVRKVKVVV 221
                                                  :..|:||..       |.|.:..:..:
  Fly   150 --------------------------------------QVIADNDFQDLKTKKRFYDTKSARAKI 176

Human   222 NFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKL-FNGQQGIII-----QNFSTRS 280
            ..:..|...:..|:.      :.| ...:..|:..||.|...: |:..:|.|.     .:..|.|
  Fly   177 LGSTEIHVKRDSTIA------LAC-SVNIHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTS 234

Human   281 ILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNPPSTAQYGITG--------SADVLFSCWYLVL 337
            .|.:|..:....||||||       .|.::   |.|...:.:||        |:.:....:..::
  Fly   235 RLMLTRASLRDSGNYTCV-------PNGAI---PASVRVHVLTGEQPAAMQTSSAIRIRAFTAMI 289

Human   338 TLSSFTSIFYLKN 350
            |:.|...:.|:.:
  Fly   290 TIISTKVLLYISS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 19/96 (20%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 68..72 CDD:409353 0/3 (0%)
Ig strand E 101..105 CDD:409353 1/3 (33%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig_3 138..207 CDD:464046 7/68 (10%)
IG_like 231..312 CDD:214653 20/86 (23%)
Ig strand B 241..245 CDD:409353 0/3 (0%)
Ig strand C 254..258 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 2/3 (67%)
Ig strand F 294..299 CDD:409353 4/4 (100%)
dpr7NP_001096850.2 V-set 56..145 CDD:462230 25/121 (21%)
Ig 184..267 CDD:472250 22/99 (22%)
Ig strand B 190..194 CDD:409353 0/9 (0%)
Ig strand C 202..206 CDD:409353 0/3 (0%)
Ig strand E 234..238 CDD:409353 2/3 (67%)
Ig strand G 261..264 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.