DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEGR1 and rig-5

DIOPT Version :9

Sequence 1:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:308 Identity:87/308 - (28%)
Similarity:130/308 - (42%) Gaps:54/308 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    35 GQSVDFPWAAVDNMMVRKGDTAVLRCYLED-GASKGAWLNRSS---------IIFAGGDKWSVDP 89
            ||.|||                  .|.:.| |:...|::...|         .:|...:|:.:.|
 Worm    99 GQDVDF------------------TCIVNDLGSHMVAFVKADSPPRLLSFDEKVFRRRNKYELKP 145

Human    90 RVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQV-HLTVQVPPKI-YDISNDMTVNE 152
            |  |..|: .::.|.|:||..:|.|.|:|.:.|:  |.|:.. .|.|:|||.: ......:.|.|
 Worm   146 R--IGDLH-NEWVLTIKNVQESDRGNYSCQINTE--PITLSTGELDVKVPPVVSRSTPAAVEVRE 205

Human   153 GTNVTLTCLATGKPEPSISWRH-----------ISPSAKPFENGQYLDIYGITRDQAGEYECSAE 206
            |.||:|||.|.|.|.|::.||.           ....|..| :|..|.:..::|....||.|.|.
 Worm   206 GNNVSLTCKADGNPTPTVIWRRQDRQIIRYNGATGFGASVF-HGPVLHLTKVSRKHMSEYLCVAS 269

Human   207 NDVSFPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLIR--CEGAGVPPPAFEWYKGEKKLFNGQQ 269
            |.:...:...||::|.|.|.:| .:|.||......:.|  |.....|.|...|.|..:.::....
 Worm   270 NGIPPDESWTVKLLVTFPPLVQ-AQSETVQASVGSMARMVCTTEAWPRPEMGWEKDGEPVYESNN 333

Human   270 GIIIQNFSTR----SILTVTNVTQEHFGNYTCVAANKLGTTNASLPLN 313
            ..:....|.:    .||.:.||...|||.|.|||.|..|..::.:.||
 Worm   334 VAMTHTVSGQYHSVHILEIRNVQSSHFGVYRCVAKNDNGIHHSQVTLN 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEGR1NP_776169.2 IG 47..135 CDD:214652 23/98 (23%)
IGc2 152..210 CDD:197706 23/68 (34%)
Ig_3 225..301 CDD:372822 23/81 (28%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 29/112 (26%)
Ig_3 191..270 CDD:372822 24/79 (30%)
IG 294..380 CDD:214652 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161450903
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I3823
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm15630
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.