DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAD1 and SecS

DIOPT Version :10

Sequence 1:NP_000808.2 Gene:GAD1 / 2571 HGNCID:4092 Length:594 Species:Homo sapiens
Sequence 2:NP_649556.3 Gene:SecS / 40681 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster


Alignment Length:217 Identity:48/217 - (22%)
Similarity:83/217 - (38%) Gaps:50/217 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    55 NSLEEKSRL--VSAFKERQSSKNLLSCENSDRDARFRRTET-DFSNLFARDLLPAKNGEEQTVQF 116
            |.||..:|:  :..|.: .|.||||....|...|.|..:.. |.::.:|     .:....|::..
  Fly   264 NQLECANRVGRIDYFVQ-SSDKNLLVPVGSAIVASFNESVLHDVASTYA-----GRASGSQSLDV 322

Human   117 LLEVVDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVR 181
            |:.::.:..|..|..||:..:..::     |.|.:..|       .|...:|::|.|        
  Fly   323 LMTLLSLGRNGFRLLFDQRGENFNY-----LRENLRKF-------AEPRGEIVIDSR-------- 367

Human   182 TGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWSSK--DG 244
                  ||.:|..:.:..|||:.:.|          |..:..::....:...|.||...:|  ||
  Fly   368 ------FNSISLAITLATLAGDQMKS----------ITKLGSMLHMRGVSGARVIVPGQNKTIDG 416

Human   245 DGIFSPGGAISNM---YSIMAA 263
            ......|...||:   |..:||
  Fly   417 HEFLDFGSHRSNLQVPYLTVAA 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAD1NP_000808.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Pyridoxal_deC 144..518 CDD:395219 27/125 (22%)
SecSNP_649556.3 AAT_I 12..457 CDD:450240 48/217 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.