DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp3 and CG1907

DIOPT Version :9

Sequence 1:NP_037299.1 Gene:Ucp3 / 25708 RGDID:3933 Length:308 Species:Rattus norvegicus
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:300 Identity:94/300 - (31%)
Similarity:140/300 - (46%) Gaps:9/300 - (3%)


- Green bases have known domain annotations that are detailed below.


  Rat     6 PSEVPPTTVVKFLGAGTAACFADLLTFPLDTAKVRLQIQGENPGVQSVQYRGVLGTILTMVRTEG 70
            |.:...|..:|||..|.:...|.::..|||..|.|:||.|...|.:  :||..|..|.|:|..||
  Fly    10 PKKAVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKK--EYRSSLHCIQTIVSKEG 72

  Rat    71 PRSPYSGLVAGLHRQMSFASIRIGLYDSVKQFYTPKGTDHSSVAIRILAGCTTGAMAVTCAQPTD 135
            |.:.|.|:.|.|.||.::.:.|:|:|..:...:..|......:...:..|...||.......|.:
  Fly    73 PLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAE 137

  Rat   136 VVKVRFQAMIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTWPNITRNAIVNCAEMVTYDIIK 200
            |..||..:..||.....|.|....:|...|.||||:..||:|:.|.:.|..:||..::.:|...|
  Fly   138 VALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFK 202

  Rat   201 EKLLDSHL-FTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMN-----APPGRYRSPLHCMLRM 259
            .......| ..:....||.::..:|...|:.:.|:|:.|||..|     ..| .||.....:||:
  Fly   203 TYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKP-EYRGTADVLLRV 266

  Rat   260 VAQEGPTAFYKGFMPSFLRLGSWNVMMFVTYEQLKRALMK 299
            ..|||..|.:|||.|.:.|||...|:.|:..|||.:...|
  Fly   267 ARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp3NP_037299.1 Mito_carr 10..107 CDD:278578 33/96 (34%)
Solcar 1 11..102 33/90 (37%)
PTZ00169 13..298 CDD:240302 91/290 (31%)
Mito_carr 109..206 CDD:278578 26/96 (27%)
Solcar 2 111..202 26/90 (29%)
Mito_carr 209..299 CDD:278578 31/94 (33%)
Solcar 3 211..296 31/89 (35%)
Purine nucleotide binding. /evidence=ECO:0000250 275..297 8/21 (38%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 33/94 (35%)
Mito_carr 118..207 CDD:278578 26/88 (30%)
Mito_carr 219..307 CDD:278578 31/88 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.