DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctsl and CG5367

DIOPT Version :9

Sequence 1:NP_037288.1 Gene:Ctsl / 25697 RGDID:2448 Length:334 Species:Rattus norvegicus
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:347 Identity:122/347 - (35%)
Similarity:199/347 - (57%) Gaps:23/347 - (6%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MTPLLLLAVLC-LGTALATPKFDQ------TFNAQWHQWKSTHRRLYGTNEEEWRR-AVWEKNMR 57
            |..|:....|| |...:.|....:      ...:::.::|:.:.|.|....:|.|. ..:|:|.:
  Fly     1 MWKLIFFGCLCGLNCQIVTSNLSEGNSSSANCKSEFEKFKNNNNRKYLRTYDEMRSYKAFEENFK 65

  Rat    58 MIQLHNGEYSNGKHGFTMEMNAFGDMTNEEF-----RQIVNGYRHQKHKKGRLFQEPLMLQIPKT 117
            :|:.||..|..|:..|.::.|.|.||:.:.:     |.:.:...........:...|||..:|::
  Fly    66 VIEEHNQNYKEGQTSFRLKPNIFADMSTDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPES 130

  Rat   118 VDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHDQGNQGCNGGL 182
            :|||.||.:||..||..||||:|||.:..:.||:|.:|||::|||:|.:||||...|||||.||.
  Fly   131 LDWRSKGFITPPYNQLSCGSCYAFSIAESIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGS 195

  Rat   183 MDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEYAVANDTGFVDIP-QQEKALMKPVATVGPIS 246
            :.....|::..||:..::.|||.|:.|.|::..:.:|.|.|.:..:| :.|:|:...|..:||::
  Fly   196 LRNTLSYLQSTGGIMRDQDYPYVARKGKCQFVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVA 260

  Rat   247 VAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVLVVGYGYEGTDSNKDKYWLVKNSWGKEWGMDGY 311
            ::::||..:.|.||.|||.:|.|||..::|.::|:|:|       || ||::||.||:.||.:||
  Fly   261 ISINASPKTFQLYSDGIYDDPLCSSASVNHAMVVIGFG-------KD-YWILKNWWGQNWGENGY 317

  Rat   312 IKIAKDRNNHCGLATAASYPIV 333
            |:|.|. .|.||:|..|:|.||
  Fly   318 IRIRKG-VNMCGIANYAAYAIV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtslNP_037288.1 Inhibitor_I29 29..87 CDD:214853 17/58 (29%)
Peptidase_C1 114..332 CDD:278538 93/218 (43%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 17/59 (29%)
Peptidase_C1A 128..336 CDD:239068 92/216 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343564
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.