DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cebpd and Irbp18

DIOPT Version :9

Sequence 1:	NP_037286.1	Gene:	Cebpd / 25695	RGDID:	2328	Length:	268	Species:	Rattus norvegicus
Sequence 2:	NP_001261698.1	Gene:	Irbp18 / 39243	FlyBaseID:	FBgn0036126	Length:	113	Species:	Drosophila melanogaster

Alignment Length:	93	Identity:	22/93 - (23%)
Similarity:	50/93 - (53%)	Gaps:	13/93 - (13%)

- Green bases have known domain annotations that are detailed below.

  Rat   187 PDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLASLR--- 248
            |....|.|:::|::||.||:::|:|.|:..:|.::::.:|..:|:.|..::|...:.:::||
  Fly    21 PHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIETSEKHISTLRDLI 85

  Rat   249 ----------QFFKELPSPPFLPPTGTD 266
                      :..:|:.:.|...|...|
  Fly    86 IQGEKTEDGHRIIQEILAEPDPDPKDND 113

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cebpd	NP_037286.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..50
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	98..132
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	152..223		12/35 (34%)
		bZIP_CEBPD	188..252	CDD:269862	17/76 (22%)
		coiled coil	191..249	CDD:269862	17/70 (24%)
		Basic motif. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	195..222		9/26 (35%)
		Leucine-zipper. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	226..254		6/40 (15%)
Irbp18	NP_001261698.1	bZIP_CEBP	24..83	CDD:269841	16/58 (28%)
Irbp18	NP_001261698.1	coiled coil	25..83	CDD:269841	16/57 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3119
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	1	1.000	-	-		otm45835
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.810