DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Has2 and kkv

DIOPT Version :9

Sequence 1:NP_037285.1 Gene:Has2 / 25694 RGDID:2781 Length:552 Species:Rattus norvegicus
Sequence 2:NP_524233.1 Gene:kkv / 45884 FlyBaseID:FBgn0001311 Length:1615 Species:Drosophila melanogaster


Alignment Length:539 Identity:104/539 - (19%)
Similarity:178/539 - (33%) Gaps:195/539 - (36%)


- Green bases have known domain annotations that are detailed below.


  Rat    40 DNYYFSFGLYGAFLASHLIIQSLFAFLEHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQ 104
            |..|:.|       .:|:.....|...:|.      :..|:.|:.|.|.||...|....:.   |
  Fly   622 DPDYYEF-------ETHIFFDDAFEISDHS------DDDIQCNRFVKLLIATMDEAASEIH---Q 670

  Rat   105 SVKRL----TYP---GIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSVTYIWKNNFHERGPGETEE 162
            :..||    .||   |.::|..:.                 |:.|.:|::               
  Fly   671 TTIRLRPPKKYPTPYGGRLVWTLP-----------------GKTKFITHL--------------- 703

  Rat   163 SHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGR-------SVD---------YVQVC 211
            ..|:..:|             .::|.   :||| .:..||.       |||         |:...
  Fly   704 KDKDRIRH-------------RKRWS---QVMY-MYYLLGHRLMELPISVDRKDAIAENTYLLTL 751

  Rat   212 DSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDS-WIS-FLSSVRYWMAFNIERACQSYF 274
            |.|....|.:...:|.:::::..:|...|.:..:..... |.. |..::.:|    :::|.:...
  Fly   752 DGDIDFKPNAVTLLVDLMKKNKNLGAACGRIHPVGSGPMVWYQLFEYAIGHW----LQKATEHMI 812

  Rat   275 GCVQCISGPLGMYRNSLL----------------HEFVEDWYNQEFMGNQCSFGDDRHLTNRVLS 323
            |||.|..|...::|...|                ..:|:  |:|         |:||.|...:|.
  Fly   813 GCVLCSPGCFSLFRGKALMDDNVMKKYTTRSDEARHYVQ--YDQ---------GEDRWLCTLLLQ 866

  Rat   324 LGYATKYTARSKCLTETPIEYLRWLNQQTRWSKS---YFREWLYNAMWFHKHH-----LWMTYEA 380
            .||..:|:|.|...|..|..:..:.||:.||..|   ...:.|.:|....|.:     |::.|:.
  Fly   867 RGYRVEYSAASDAYTHCPEGFNEFYNQRRRWVPSTIANIMDLLADAKRTIKINDNISLLYIFYQM 931

  Rat   381 VITG---FFP---FFLIATVIQLFYRGKIW----------------------NILLFLLTVQ--- 414
            ::.|   ..|   |.::.......:|...|                      ||.||:..|.   
  Fly   932 MLMGGTILGPGTIFLMLVGAFVAAFRIDNWTSFHYNIVPILAFMFICFTCKSNIQLFVAQVLSTA 996

  Rat   415 ----------------------------LVGLIKSSF-ASCLRGN----IVMVFMSLYSVLYMSS 446
                                        |:.::.|.| |:||...    |....:.|.|:..|..
  Fly   997 YALIMMAVIVGTALQLGEDGIGSPSAIFLISMVGSFFIAACLHPQEFWCITCGLIYLLSIPSMYL 1061

  Rat   447 LLPAKMFAIATINKAGWGT 465
            ||  .:::|..:|...|||
  Fly  1062 LL--ILYSIINLNVVSWGT 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Has2NP_037285.1 nodulat_NodC 48..463 CDD:275076 98/527 (19%)
GT2_HAS 84..361 CDD:133056 64/320 (20%)
kkvNP_524233.1 Chitin_synth_C 583..904 CDD:133033 72/361 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11041
eggNOG 1 0.900 - - E1_COG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.