DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppard and Hr96

DIOPT Version :9

Sequence 1:NP_037273.2 Gene:Ppard / 25682 RGDID:3370 Length:440 Species:Rattus norvegicus
Sequence 2:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster


Alignment Length:363 Identity:84/363 - (23%)
Similarity:140/363 - (38%) Gaps:81/363 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat    73 CRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLKYEKC--DRICKIQKKNRNKCQYCRFQKCLAL 135
            |.||||||.|:::....||.||.||||....|.:: .|  ::.|.|....|..||.||.:|||.:
  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQF-TCPFNQNCDITVVTRRFCQKCRLRKCLDI 70

  Rat   136 GMSHNAIRFGRMPEAE-------------KRKLVAGLT---ASEGCQQNPQLADLKAFSKHIYNA 184
            ||....|    |.|.:             ||:|:...|   .::|.::....|...:.|.::.:.
  Fly    71 GMKSENI----MSEEDKLIKRRKIETNRAKRR
LMENGTDACDADGGEERDHKAPADSSSSNLDHY 131

  Rat   185 YLKNFNMTKKKARSILTGKSSHNAPFIIHDIETLWQAEKGLVWKQLVNGPPPYNEISVHVFYRCQ 249
            .....:.:...|.|...|.|...|......:..|....:.:| .|:|:.|...:: :::...|.|
  Fly   132 SGSQDSQSCGSADSGANGCSGRQASSPGTQVNPLQMTAEKIV-DQIVSDPDRASQ-AINRLMRTQ 194

  Rat   250 STTVET--------------VRELTEFAKNIPNFSSLFLNDQVTLLKYGVHEAIFAMLAS----- 295
            ...:..              |..|.::..:.....|.|:|.....|      .:|....|     
  Fly   195 KEAISVMEKVISSQKDALRLVSHLIDYPGDALKIISKFMNSPFNAL------TVFTKFMSSPTDG 253

  Rat   296 --IVNKDGLLVANGSGFVTHEFLRSIRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCG 358
              |::|   :|.:.:..|  ||::::.....|.|:...:|        ::....||.|...||.|
  Fly   254 VEIISK---IVDSPADVV--EFMQNLMHSPEDAIDIMNKF--------MNTPAEALRILNRILSG 305

  Rat   359 ----------DR-PGLMNVPQVEAI-----QDTILQAL 380
                      || |.|...|.|:..     .||::|::
  Fly   306 GGANAAQQTADRKPLLDKEPAVKPAAPAERADTVIQSM 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpardNP_037273.2 NR_DBD_Ppar 72..155 CDD:143523 35/96 (36%)
NR_LBD_PPAR 172..439 CDD:132730 46/246 (19%)
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 34/95 (36%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.890

Return to query results.
Submit another query.