DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Il1r1 and CG45263

DIOPT Version :9

Sequence 1:NP_037255.3 Gene:Il1r1 / 25663 RGDID:2892 Length:590 Species:Rattus norvegicus
Sequence 2:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster


Alignment Length:393 Identity:82/393 - (20%)
Similarity:143/393 - (36%) Gaps:82/393 - (20%)


- Green bases have known domain annotations that are detailed below.


  Rat     9 SAKSSILE---NMKVLLGFICLIVPLLSLETDKCTEYPNEVISFSSVNEIDIRSCPLTPNEMHGG 70
            :|||.::|   ::|.......:..|.:.||.||               :..:..|....|.  ..
  Fly   269 TAKSVVVEARLDVKYAPSIRLIGSPEIDLEEDK---------------DALVLRCVADANP--PA 316

  Rat    71 TIIWYKNDSKTPISADKDSRIHQQNEHLWFVPAKMEDSGYYYCIMRNS-------TYCLKTKITM 128
            :|:|.:...         |.|....|.|...|....|:|.|.|..:||       :..|..|...
  Fly   317 SIVWRRAGR---------SEIASLQETLQLRPVGRRDAGLYTCQAQNSVGTSEQLSVQLDVKYPP 372

  Rat   129 SVLENDPGLCYNTQASFIQRLHVAGDGSLVCPYLDFFKDENNELPKVQWYKNCKPLPLDDGNFF- 192
            .::...|           .||..|   .|..|.......:.|.||..:|.:.     :..|:.: 
  Fly   373 KIISAGP-----------DRLTTA---PLFSPAAFECLADGNPLPSFKWVQR-----MAHGSKYV 418

  Rat   193 --GFKNKLMVMNVAEEHRGNYTCR-TSYTYQGKQYPVTRVITFITIDDSKRDRPVIMSPRNETME 254
              |.:::|::.||..|::|.|.|| |||....::..::..::...:...:..|   :.|...|:.
  Fly   419 ERGSESRLVIDNVTYEYQGEYECRATSYINGQERVAISDPVSLQVVGAPQVLR---LHPSLHTVS 480

  Rat   255 ADPG---STIQLICNVTGQFTDLVYWKWNGSEIEWD---DPILAEDYQFLEHPSAKRKYTLITTL 313
            ...|   |...::|  .......|.|:|....:|..   |...|:|.|    |.. |:...::||
  Fly   481 VKRGEAASLTMVVC--ADPRPQRVAWEWGSLRLEAGSGIDRFRADDMQ----PDT-REDCYLSTL 538

  Rat   314 NVSEVKSQFYRYPFICFVKNTHILETAHVRLV----YPVPDFKNYLIG--GFAIFTATAVFCACI 372
            ::........| |:...|:|....:...:.|:    :..|...:||:|  |..:.....:.|.||
  Fly   539 HILHADEHDSR-PYYLVVENERGTDRHAIHLIVEGTFAEPYEMSYLMGVAGGCMAAILLLVCLCI 602

  Rat   373 YKV 375
            |.:
  Fly   603 YAI 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Il1r1NP_037255.3 Ig 47..130 CDD:299845 17/89 (19%)
Ig2_IL1R_like 144..236 CDD:143234 22/95 (23%)
Ig_3 242..333 CDD:290638 21/96 (22%)
IG_like 251..344 CDD:214653 20/98 (20%)
TIR 401..556 CDD:214587
CG45263NP_731246.2 I-set 53..149 CDD:254352
Ig 198..281 CDD:299845 4/11 (36%)
IG_like 302..368 CDD:214653 16/76 (21%)
IGc2 302..357 CDD:197706 15/65 (23%)
Ig 372..446 CDD:299845 21/92 (23%)
Ig 475..568 CDD:299845 20/100 (20%)
IG_like 478..570 CDD:214653 21/99 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.