DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND2 and ND2

DIOPT Version :9

Sequence 1:NP_006957.1 Gene:ND2 / 2565695 -ID: Length:282 Species:Caenorhabditis elegans
Sequence 2:YP_009047266.1 Gene:ND2 / 19893529 FlyBaseID:FBgn0013680 Length:341 Species:Drosophila melanogaster


Alignment Length:364 Identity:85/364 - (23%)
Similarity:140/364 - (38%) Gaps:119/364 - (32%)


- Green bases have known domain annotations that are detailed below.


 Worm     2 IVFISLFTLFLTLLSILTNNVIVWW---SIFLLMTVVFILLNKSSKSYTSIFNYFVIQESLGLLF 63
            |:||::. :..||:::.:|:.:..|   .|.||..:..:..|.:..|..:...||:.| .|....
  Fly     8 ILFITIM-IIGTLITVTSNSWLGAWMGLEINLLSFIPLLSDNNNLMSTEASLKYFLTQ-VLASTV 70

 Worm    64 LLCSGGLLQ------------------FFIILLKIGVAPLHFWIFNVTNNIFNYGLMW-----FL 105
            ||.|..||.                  ...:|||.|.||.|||..|:..     ||.|     .:
  Fly    71 LLFSSILLMLKNNMNNEINESFTSMIIMSALLLKSGAAPFHFWFPNMME-----GLTWMNALMLM 130

 Worm   106 TFQKLPFLTILLQIFWLSSVYILLFGLLICYVQIFV----MKSYKNLLIISSTESFNWIVLGVFF 166
            |:||   :..|:.|.:|:..|:||..:::..:...:    ..|.:.|:..||.....|::..:..
  Fly   131 TWQK---IAPLMLISYLNIKYLLLISVILSVIIGAIGGLNQTSLRKLMAFSSINHLGWMLSSLMI 192

 Worm   167 SMFNTFYLFIYYFVLMVLLISKFSKTSGYNFINWETTLVFLNIPFSVSFFVKIFSLSEIFKY--D 229
            |  .:.:|..::|               |:|:::..|.:| ||       .|:|.|:::|.:  :
  Fly   193 S--ESIWLIYFFF---------------YSFLSFVLTFMF-NI-------FKLFHLNQLFSWFVN 232

 Worm   230 SFFTLFLLFTMFLSV------LAF-SFWLI----------------------------------- 252
            |....|.||..|||:      |.| ..||:                                   
  Fly   233 SKILKFTLFMNFLSLGGLPPFLGFLPKWLVIQQLTLCNQYFMLTLMMMSTLITLFFYLRICYSAF 297

 Worm   253 -------NLSMKNNEETSNNNK---MNYFIIFPLMVISI 281
                   |..||.|..:.|.|.   |.:|.||.|.:||:
  Fly   298 MMNYFENNWIMKMNMNSINYNMYMIMTFFSIFGLFLISL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND2NP_006957.1 ND2 17..282 CDD:177154 80/349 (23%)
ND2YP_009047266.1 ND2 1..340 CDD:214442 85/364 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153818at2759
OrthoFinder 1 1.000 - - FOG0002463
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102147
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2690
SonicParanoid 1 1.000 - - X2194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.