DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Selp and CG7763

DIOPT Version :9

Sequence 1:NP_037246.2 Gene:Selp / 25651 RGDID:3656 Length:768 Species:Rattus norvegicus
Sequence 2:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster


Alignment Length:142 Identity:31/142 - (21%)
Similarity:63/142 - (44%) Gaps:11/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Rat    22 QLVWLSALISELVNQKEV-----AAWTYNYSTKAYSWNNSRAFCKRHFTDLVAIQNKNEIAHLND 81
            ||:.....:...:.:.|:     :.:.|....:..:|:::...|.:....|.::|::.|:...|:
  Fly    91 QLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNN 155

  Rat    82 VIPYVNSYYWIGIRKINNKWTWVGTNKTLTAEAENWADNEPNNKRNNQDCVEIYIKSNSAPGKWN 146
            .:..:|. |||.:....|:..:|...|...|...:|||.||.   .:.:||:  |::.:.....|
  Fly   156 QLNGLNR-YWIDVTNQFNESEFVSVTKGSKANFLSWADGEPT---KDGECVD--IRTFNGKTTMN 214

  Rat   147 DEPCFKRKRALC 158
            |..||.....:|
  Fly   215 DNSCFANLYFIC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SelpNP_037246.2 CLECT_selectins_like 42..160 CDD:153062 28/117 (24%)
EGF_CA <168..195 CDD:238011
CCP 200..258 CDD:153056
PHA02927 276..505 CDD:222943
PHA02927 443..699 CDD:222943
Endocytosis signal. /evidence=ECO:0000305 756..759
Interaction with SNX17. /evidence=ECO:0000250 759..768
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 28/117 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.