DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gnai3 and Galphaq

DIOPT Version :9

Sequence 1:NP_037238.1 Gene:Gnai3 / 25643 RGDID:2714 Length:354 Species:Rattus norvegicus
Sequence 2:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster


Alignment Length:400 Identity:181/400 - (45%)
Similarity:235/400 - (58%) Gaps:52/400 - (13%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDE 65
            |.|.||.|.|.....::.|::.||.|...|.:|:||||||.|||||||.:|||:|||..|||:::
  Fly     1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 65

  Rat    66 CKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAE-EGVMTSE--LAGVI 127
            .:.|..:|:.|...::.::|:||..|||.:|:...:    :|..|..|.: |.|.|.|  ....|
  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHS----ELADLVMSIDYETVTTFEDPYLNAI 126

  Rat   128 KRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVKTTGIVETHFTFK 192
            |.||.|.|:|.|:.|.|||||.|||.|||.||||::|..|:||:||:||.||.||||:|..|..:
  Fly   127 KTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLE 191

  Rat   193 E-------------------------------------------LYFKMFDVGGQRSERKKWIHC 214
            |                                           :.|:|.|||||||||:|||||
  Fly   192 EIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHC 256

  Rat   215 FEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIK 279
            ||.||:|||.||||:||.:|.|.:..|||.||..||.:|....||.::|:|||||||||.||||.
  Fly   257 FENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIM 321

  Rat   280 RSPLTICYPEYTG-SNTYEEAAAYIQCQFEDLNRRKDTKEVYTHFTCATDTKNVQFVFDAVTDVI 343
            .|.|...:|||.| ......|..:|...|.|||...: |.:|:||||||||:|::.||.||.|.|
  Fly   322 YSHLVDYFPEYDGPQRDAITAREFILRMFVDLNPDSE-KIIYSHFTCATDTENIKLVFCAVKDTI 385

  Rat   344 IKNNLKECGL 353
            ::|.|||..|
  Fly   386 MQNALKEFNL 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gnai3NP_037238.1 G-alpha 34..348 CDD:206639 165/360 (46%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 35..48 11/12 (92%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 173..181 5/7 (71%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 196..205 6/8 (75%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 265..272 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 324..329 4/4 (100%)
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 165/360 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.