DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp3a23-3a1 and Cyp6d2

DIOPT Version :9

Sequence 1:NP_037237.2 Gene:Cyp3a23-3a1 / 25642 RGDID:628626 Length:502 Species:Rattus norvegicus
Sequence 2:NP_611698.1 Gene:Cyp6d2 / 37594 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster


Alignment Length:533 Identity:149/533 - (27%)
Similarity:258/533 - (48%) Gaps:72/533 - (13%)


- Green bases have known domain annotations that are detailed below.


  Rat    12 WVLLAVVLV--LLYGFGTRTHGLFKKQGI-PGPKPLPF--FGTVLNYYMGLWKFDVECHKKY-GK 70
            |.:|..:|:  |||.:..|.:..:::.|: ..|..:||  ..||:.....|.....:.:.:: ||
  Fly     2 WTILLTILIAGLLYRYVKRHYTHWQRLGVDEEPAKIPFGVMDTVMKQERSLGMALADIYARHEGK 66

  Rat    71 IWGLFDGQMPLFAITDTEMIKNVLVKECFSVFTNRRDFGPVGIMGKAISVSKD-----------E 124
            |.|::........|.|.::.:.::..: |:.|.:|         |..:...||           .
  Fly    67 IVGIYMLNKRSILIRDAQLARQIMTSD-FASFHDR---------GVYVDEDKDPLSANLFNLRGA 121

  Rat   125 EWKRYRALLSPTFTSGRLKEMFPVIEQYGDILVKYLR--QEKGKPVPVKEVFGAYSMDVITSTSF 187
            .|:..|..|:|:|:||::|.||..|:..||.||::|.  .::...|.:|:|...|::|:|.|..|
  Fly   122 SWRNLRQKLTPSFSSGKIKGMFGTIDDVGDKLVQHLEGALDQSDEVEIKDVMTTYAVDIIGSVIF 186

  Rat   188 GVNVDSLNNPKDPFVEKAKK-------LLRIDFFDPLFLSVVLFPFLTPVYEMLNICMFPKDSIE 245
            |:.:||..|||:.|.|.:..       ||:|.     .:|:.:.|   |:.:::|...:....:.
  Fly   187 GLEIDSFRNPKNEFREISSSTSRDESLLLKIH-----NMSMFICP---PIAKLMNRLGYESRILT 243

  Rat   246 FFKKFVYRMKETRLDSVQKHRV---DFLQLMMNAHNDSKDKESHTALSDME-------------I 294
            ..:..:.|..|.|    ::|.|   |.|||::...|..|..|....:.|||             |
  Fly   244 SLRDMMKRTIEFR----EEHNVVRKDMLQLLIRLRNTGKIGEDDDQVWDMETAQEQLKSMSIEKI 304

  Rat   295 TAQSIIFIFAGYEPTSSTLSFVLHSLATHPDTQKKLQEEIDRAL--PNKAPP---TYDTVMEMEY 354
            .||:.:|..||.|.|::..:|.|:.|:.:|:..|:.|||:|..|  .|..|.   ||:.|.::::
  Fly   305 AAQAFLFYVAGSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFTYEAVQDLKF 369

  Rat   355 LDMVLNETLRLYPIGNRLERVCKKDVEINGV--FMPKGSVVMIPSYALHRDPQHWPEPEEFRPER 417
            ||:.:.||:|.||....|.|.|.:|..:.|.  .:.||:.::|..:.:.|||.::|.|..:.|.|
  Fly   370 LDICIMETIRKYPGLPFLNRECTEDYPVPGTNHIIAKGTPILISLFGMQRDPVYFPNPNGYDPHR 434

  Rat   418 FSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIPLKLSRQGLL 482
            |...|. :.|...|:|||.|||:||.:|...:|.|:|:.|:|.||........::..:.....:|
  Fly   435 FDSNNM-NYDQAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANFDLVQSPRKEVEFRFDAAPVL 498

  Rat   483 QPTKPIILKVVPR 495
            ...:|:.|::..|
  Fly   499 VTKEPLKLRLTKR 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp3a23-3a1NP_037237.2 p450 39..492 CDD:278495 140/498 (28%)
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 133/463 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.