DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp3a23-3a1 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_037237.2 Gene:Cyp3a23-3a1 / 25642 RGDID:628626 Length:502 Species:Rattus norvegicus
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:511 Identity:143/511 - (27%)
Similarity:240/511 - (46%) Gaps:51/511 - (9%)


- Green bases have known domain annotations that are detailed below.


  Rat    12 WVLLAVVLVLLYGFGTR-THGLFKKQGIP-----GPKPLPFFGTVL-------NYYMGLWKFDVE 63
            |:||..::.|  .|..| .:..|:.:|||     ...|:...|.:|       :.:..|:   .:
  Fly     5 WLLLLTIVTL--NFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLY---AD 64

  Rat    64 CHKKYGKIWGLFDGQMPLFAITDTEMIKNVLVKECFSVFTNR---RDFG-PVGIMGKAISVSKDE 124
            ......||.|.|..|.|...:.|.|:|:.||:|. |:.|.||   .|.| |:|.:  .:.::|..
  Fly    65 PRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKN-FNNFLNRFESADAGDPMGAL--TLPLAKYH 126

  Rat   125 EWKRYRALLSPTFTSGRLKE-MFPVIEQYGDILVKYLRQEKG----KPVPVKEVFGAYSMDVITS 184
            .||..|..:|..|||||::: |:..:......|.:||.::.|    :.:|:..:...|:.||..:
  Fly   127 HWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGN 191

  Rat   185 TSFGVNVDSLNNPKDPFVEKAKKLLRIDFFDPL-FLSVVLFPFLTPVYEMLNICMFPKDSIEFFK 248
            ..:.:||..|...:...:.|.|:|...:....| |:||...|..|.|.:       ||...|.:.
  Fly   192 LFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLK-------PKVFTEDYA 249

  Rat   249 KFVYRMKETRLDSVQKHRVDFLQLMMNAHNDSKDKESHTALSDMEITAQSIIFIFAGYEPTSSTL 313
            :::..:.:...:..:...::.||     |.......:|.:.....:.:|:.|.:.||:|.:|:.:
  Fly   250 RYMRHLVDDHHEPTKGDLINQLQ-----HFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALM 309

  Rat   314 SFVLHSLATHPDTQKKLQEEIDRALPNKAPPTYDTVMEMEYLDMVLNETLRLYPIGNRLERVCKK 378
            .|.|:.||..||.|::|:.|:..|..:.|..:|||:|.:.||.||..|.|||||....:.|.|..
  Fly   310 GFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTS 374

  Rat   379 DVEINGVFMPKGSVVM---IPSY----ALHRDPQHWPEPEEFRPERFSKENKGSIDPYVYLPFGN 436
            .........|....::   :|:|    .||||.:.||||..|.||||..|....|.|..|:|||.
  Fly   375 SASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGA 439

  Rat   437 GPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIPLKLS-RQGLLQPTKPIILK 491
            ||..|||.|..::.:||.:..:|:.:..:.|:.|...::.: :..:|:....|.|:
  Fly   440 GPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp3a23-3a1NP_037237.2 p450 39..492 CDD:278495 134/483 (28%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 130/469 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.