DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp3a23-3a1 and Cyp309a2

DIOPT Version :9

Sequence 1:NP_037237.2 Gene:Cyp3a23-3a1 / 25642 RGDID:628626 Length:502 Species:Rattus norvegicus
Sequence 2:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster


Alignment Length:525 Identity:140/525 - (26%)
Similarity:243/525 - (46%) Gaps:93/525 - (17%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MDLLSALTLETWVLLAVVLVLLYGFGTRTHGLFKKQGIPGPKPLPFFGTVLNYYMGLWK------ 59
            |.:|::|.|   :||.::::.:|.:.|..|..::|:|:...:||...||    |.||..      
  Fly    32 MYILASLAL---ILLHLLVLPIYLYLTWHHKYWRKRGLVTARPLTLLGT----YPGLLTRKSNLV 89

  Rat    60 FDVE-CHKKY-GK--IWGLFDGQMPLFAITDTEMIKNVLVKECFSVFTNRRDFGPVGIMGKAISV 120
            |||: .:.|| ||  ..|:|..:.|...:.|.|:...|||    |.|...:|       ....|.
  Fly    90 FDVQKIYDKYKGKHRAVGVFVTRQPQILVLDPELAHEVLV----SNFRCYKD-------SLQSSY 143

  Rat   121 SKDEEWKRYRALLSPTFTSG-----------------RLKEMFPVIEQYGDILVKYLRQ---EKG 165
            .:..:|.:| |.|:|.:.||                 ||::.:.:.||.|.:|.:|:.|   ||.
  Fly   144 LRHAKWDKY-ARLNPFWASGQSWRRLRTDAQAGISGSRLRQAYNIWEQGGQMLTEYMTQQVAEKN 207

  Rat   166 KPVPVKEVFGAYSMDVITSTSFGVNVDSLNNPKD---PFVEKAKKLLRIDFFD-PLFLSVVLFPF 226
            ..:..:::...|:..|:....:|::..:|..|.:   ...|.|.|.....|:. .||::.::.|.
  Fly   208 NILETRDLCFRYTAHVMADFIWGIDAGTLTRPMEQPNKVQEMASKWTSYAFYMLTLFMATIVAPC 272

  Rat   227 LTPVYEMLNICMFPKDSIEFFKKFVYRMKETRLDSVQKHRVDFLQLMMNAHNDSKDKESHTALSD 291
            ..   .:|....:||::.|||........|.||.:....|.|:|..::..      ::...|..|
  Fly   273 SR---LLLRFRFYPKETDEFFSNLTKESIELRLKAGDSTRTDYLSHLLQL------RDQKQATHD 328

  Rat   292 MEITAQSIIFIFAGYEPTSSTLSFVLHSLATHPDTQKKLQEEIDRALPNKAPPTYDTVMEMEYLD 356
             ::...::..:..||:.:.:.|...|:.||.:|..|:||:.||...:.::....::.:..::||:
  Fly   329 -DLVGHALTVMLDGYDTSGTALLHALYYLAENPAVQQKLRVEILSCMASEKSLDFEKLSSLQYLE 392

  Rat   357 MVLNETLRLYPIGNRLERVC------------KKDVEINGVFMPKGSVVMIPSYALHRDPQHWPE 409
            .|:.|:|||..:..:..:||            ..|||:       |..:|||:|..|.|.|::||
  Fly   393 QVIYESLRLSSLIPQYTKVCTLPTVIRLSESKSLDVEV-------GMTIMIPNYQFHHDKQYFPE 450

  Rat   410 PEEFRPERFSK------ENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCK 468
            ||.|:||||..      ..||     ::|||.:|||.|:|:..|::.:|.||..:|.||.....:
  Fly   451 PEAFKPERFDNGAYQELMRKG-----IFLPFSDGPRICMGVPLAMLTLKSALVHILSNFQVVRGR 510

  Rat   469 ETQIP 473
            :..||
  Fly   511 DRLIP 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp3a23-3a1NP_037237.2 p450 39..492 CDD:278495 129/487 (26%)
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 129/484 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.