DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCML4 and sor-3

DIOPT Version :10

Sequence 1:XP_047274551.1 Gene:SCML4 / 256380 HGNCID:21397 Length:467 Species:Homo sapiens
Sequence 2:NP_508090.2 Gene:sor-3 / 180391 WormBaseID:WBGene00015429 Length:531 Species:Caenorhabditis elegans


Alignment Length:140 Identity:29/140 - (20%)
Similarity:49/140 - (35%) Gaps:34/140 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   130 KDPIRPQSDPLPSNPVRVAVCLYINK------QANAGPYL----ERKKVQQLPEHFGP------- 177
            ||.|.| ...|..||..:.|..::..      |......:    |.:|...|.:|..|       
 Worm    83 KDDIFP-CKILTRNPENLFVARFLESGKEKHIQVEYSDIIMTRSELEKALPLCQHLIPARNWDDF 146

Human   178 ------ERPSAVLQQAVQACIDCAHQQKL---------VFSLVKQGYGGEMVSVSASFDGKQHLR 227
                  |:.:...:|.:.|.:....|.:|         |.:.|.:.|.|.::....:|....|:.
 Worm   147 YIIRDFEKATPYFEQGLSALVKPGQQFELQLEDAPDFYVMATVVKNYRGFLLVEYQNFKRWIHML 211

Human   228 SLPVVNSIGY 237
            | |..:.||:
 Worm   212 S-PYCHEIGW 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCML4XP_047274551.1 RBR 1..53 CDD:465382
SLED 149..258 CDD:463469 22/121 (18%)
SAM_Scm 393..464 CDD:188977
sor-3NP_508090.2 MBT 167..222 CDD:439080 12/55 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.