DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABRD and GluClalpha

DIOPT Version :9

Sequence 1:XP_016856425.1 Gene:GABRD / 2563 HGNCID:4084 Length:687 Species:Homo sapiens
Sequence 2:NP_001287408.1 Gene:GluClalpha / 42350 FlyBaseID:FBgn0024963 Length:463 Species:Drosophila melanogaster


Alignment Length:441 Identity:146/441 - (33%)
Similarity:226/441 - (51%) Gaps:56/441 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   279 LDGLI-AG-YARNFRP-GIGGP--PVNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLSYN 338
            ||.:: || |....|| ||.|.  |..|.:.:.|.||..|.:..|||::.:...:.|.|.||.::
  Fly    37 LDQILGAGKYDARIRPSGINGTDGPAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERLKFD 101

Human   339 HTNETLG-LDSRFVDKLWLPDTFIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITSTVACDMD 402
            .....|. |.....:::|:||.|..|.|...||::.:.|..||:.|:|.:||||||:.|:||.|:
  Fly   102 DIQGRLKYLTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMN 166

Human   403 LAKYPMDEQECMLDLESYGYSSEDIVYYWSESQEHIHGLDKLQLAQFTITSYRFTTELMNFK-SA 466
            |..||:|.|.|.|.:.|||:::.|:|:.|.|. :.:..:..|.|.:||:.  :|.|:..|.| :.
  Fly   167 LKLYPLDRQICSLRMASYGWTTNDLVFLWKEG-DPVQVVKNLHLPRFTLE--KFLTDYCNSKTNT 228

Human   467 GQFPRLSLHFHLRRNRGVYIIQSYMPSVLLVAMSWVSFWISQAAVPARVSLGITTVLTMTTLMVS 531
            |::..|.:....:|....|:||.|:|..:||.:||||||:.|.|||||||||:||:|||.|....
  Fly   229 GEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSG 293

Human   532 ARSSLPRASAIKALDVYFWICYVFVFAALVEYAFAHF-------NADYRKKQKAKVKVSRPRAEM 589
            ..:|||..|..||:||:..:|..|||.||:|:|..::       .|:..|:...|.:....:|.:
  Fly   294 INASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSGSNKANMHKENMKKKRRDLEQASL 358

Human   590 DVRNAIV---------LFSLSAAGVTQELAISRRQRRVPGNLMGSYRSVGVETGETKKEGAARSG 645
            |..:.::         :.|..|.|..|:..:.|.    ||:.:...:.:..|.            
  Fly   359 DAASDLLDTDSNATFAMASQFARGGGQQKPLVRH----PGDPLALEKRLQCEV------------ 407

Human   646 GQGGIRARLRPIDADT-----------IDIYARAVFPAAFAAVNVIYWAAY 685
               .::|..||....|           ||:.:|..||..||..|::||:.|
  Fly   408 ---HMQAPKRPNCCKTWLSKFPTRSKRIDVISRITFPLVFALFNLVYWSTY 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABRDXP_016856425.1 None
GluClalphaNP_001287408.1 LIC 3..455 CDD:273305 145/439 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.