DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTF1A and CG33557

DIOPT Version :9

Sequence 1:NP_835455.1 Gene:PTF1A / 256297 HGNCID:23734 Length:328 Species:Homo sapiens
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:90 Identity:33/90 - (36%)
Similarity:48/90 - (53%) Gaps:11/90 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   142 SGAAAAAARRRRRVRSEA-----------ELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPY 195
            ||:.|||.....::..||           ..:..||..|.|||.|..::|.|:|.||:.|||.|.
  Fly    29 SGSGAAADSEDSQIGQEANPGGQENQGNHRRRPPRQKINARERYRTFNVNSAYEALRNLIPTEPM 93

Human   196 EKRLSKVDTLRLAIGYINFLSELVQ 220
            .::|||::.:|||..||..||..::
  Fly    94 NRKLSKIEIIRLASSYITHLSSTLE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTF1ANP_835455.1 HLH 165..220 CDD:238036 26/54 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..278
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328
CG33557NP_001014730.1 HLH 67..119 CDD:197674 24/52 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.