DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTF1A and Fer1

DIOPT Version :9

Sequence 1:NP_835455.1 Gene:PTF1A / 256297 HGNCID:23734 Length:328 Species:Homo sapiens
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:344 Identity:98/344 - (28%)
Similarity:130/344 - (37%) Gaps:137/344 - (39%)


- Green bases have known domain annotations that are detailed below.


Human     1 MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEYCYRDG 65
            ::|.:..||..|..|..:|....|.||.|:.|.:..::.|..                       
  Fly     9 LEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY----------------------- 50

Human    66 ACLLLQPAPPAAPLALAPPSSGGLGEPDDGGGGGYCCETGAPPGGFPYSPGSPPSCLAYPCAGAA 130
                                |.|.....:.....:|          |:|..|             
  Fly    51 --------------------SSGFNSDQENTEKTFC----------PFSRRS------------- 72

Human   131 VLSPGARLRGLSGAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPY 195
                               .:.||::..:::.|.|||||:||||||||||:||||||:|||||||
  Fly    73 -------------------HKPRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPY 118

Human   196 EKRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQ-------- 252
            ||||||||||:|||.||.||||:|:.|                   ..|:.||...|        
  Fly   119 EKRLSKVDTLKLAISYITFLSEMVKKD-------------------KNGNEPGLSLQRNYQKEPP 164

Human   253 -KVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPR--------- 307
             |:|:          .|...|:    .|||||. .|..:.......|:.|||||||         
  Fly   165 KKIIL----------KDRTGGV----AHSLSWY-RKGDRYPGSKLYARTWTPEDPRGPHSQPLPL 214

Human   308 KLNSKSSFNNIENEPPFEF 326
            ..||.|:.|...|:...:|
  Fly   215 YNNSNSNQNQNSNQSSDDF 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTF1ANP_835455.1 HLH 165..220 CDD:238036 47/54 (87%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..278 2/18 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328 9/31 (29%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 44/51 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147068
Domainoid 1 1.000 94 1.000 Domainoid score I7510
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4827
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1269550at2759
OrthoFinder 1 1.000 - - FOG0008172
OrthoInspector 1 1.000 - - oto91156
orthoMCL 1 0.900 - - OOG6_108748
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 1 1.000 - - X6136
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.