DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NUDT14 and CG18094

DIOPT Version :10

Sequence 1:NP_803877.2 Gene:NUDT14 / 256281 HGNCID:20141 Length:222 Species:Homo sapiens
Sequence 2:NP_609974.3 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster


Alignment Length:165 Identity:39/165 - (23%)
Similarity:54/165 - (32%) Gaps:56/165 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    55 LVLVKQFRPAVYAGEVERRFPGSLAAVDQDGPRELQPA----LPGSAGVT---VELCAGLVDQP- 111
            |:|:|:.....||.. ...|||.:.     .|.|.|.|    ...|.|||   :::|....|.| 
  Fly    30 LLLIKRTEKTSYALN-HCVFPGGVF-----DPIEDQSAKWITFFKSFGVTDEQLKMCRHNQDSPR 88

Human   112 ------------GLSLEEVACKEAWEECGYHLAPSDLRRVATYWSGVGLTGSRQTMFYTEVTDAQ 164
                        .::|...|.:|.:||.|                         .:..||..|.|
  Fly    89 PEFLSGGDHISRDIALRLTALRETFEEVG-------------------------ILICTEQDDIQ 128

Human   165 ----RSG-PGGGLVEEGELIEVVHLPLEGAQAFAD 194
                :|| |...|:|..|..|..|.....|..|.:
  Fly   129 KWDSKSGHPRTVLLESSEHFEWQHRVHNDASQFLE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NUDT14NP_803877.2 NUDIX_UGPPase_Nudt14 25..212 CDD:467597 39/165 (24%)
Nudix box 111..129 6/30 (20%)
CG18094NP_609974.3 NUDIX_Hydrolase 10..251 CDD:469772 39/165 (24%)

Return to query results.
Submit another query.