DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NUDT14 and Datp

DIOPT Version :10

Sequence 1:NP_803877.2 Gene:NUDT14 / 256281 HGNCID:20141 Length:222 Species:Homo sapiens
Sequence 2:NP_723505.2 Gene:Datp / 318908 FlyBaseID:FBgn0287788 Length:142 Species:Drosophila melanogaster


Alignment Length:53 Identity:14/53 - (26%)
Similarity:18/53 - (33%) Gaps:16/53 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   106 GLVDQPGLSLEEVACKEAWEECGY---------------HLAPSDLRRVATYW 143
            |.|| ||......|.:|..||.||               :....|..::..||
  Fly    36 GHVD-PGEDDFTTALRETKEEAGYDEKDLIIYKDTPLTLNYQVQDKPKIVIYW 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NUDT14NP_803877.2 NUDIX_UGPPase_Nudt14 25..212 CDD:467597 14/53 (26%)
Nudix box 111..129 6/17 (35%)
DatpNP_723505.2 NUDIX_Ap4A_Nudt2 1..135 CDD:467534 14/53 (26%)

Return to query results.
Submit another query.