DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cma1 and CG18420

DIOPT Version :9

Sequence 1:NP_037224.1 Gene:Cma1 / 25627 RGDID:2365 Length:247 Species:Rattus norvegicus
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:290 Identity:87/290 - (30%)
Similarity:124/290 - (42%) Gaps:73/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Rat     5 ALCLLLL----LLGSS------------TKAG-EIIGGTECIPHSRPYMAYLEIVTSDNYLSACS 52
            |..||||    ||||:            .|.| .|:.|...:.:|.|:||:|.  ||.|.. .|.
  Fly     9 ASILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLH--TSSNQF-ICG 70

  Rat    53 GFLIRRNFVLTAAHC--AGRSITVLLGAHN---KTYKEDTWQKLEVEKQFIHPNYDKRLVLHDIM 112
            |.||.|..|||||||  ...:|.|.||.:|   |.|:|:.    :|.:.|.|..||.....:||.
  Fly    71 GTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEH----QVNRTFQHRFYDPNTHANDIA 131

  Rat   113 LLKLKEKAKLTLGVGTLPLSANF------------NFIPPGRMCRAVGWGRTNVNEPASDTLQEV 165
            ||:|         |..:...||.            :.|...::....|||||.....:|: |:.:
  Fly   132 LLRL---------VSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSE-LRTL 186

  Rat   166 KMRLQEPQSCKHFTSFQHKSQLCVGNPKKMQNVYKGDSGGPL------------LCAGIAQGIAS 218
            .:..|..:.|. |.|.. .:|.|.||..  .|:..||:|||:            :..|||     
  Fly   187 DISRQPSKMCA-FGSVL-SNQFCAGNWN--SNLCIGDTGGPVGAMVRYRNAFRFVQVGIA----- 242

  Rat   219 YVHPNAKPPAVFTRISHYRPWINKI-LREN 247
            ..:...:.|:|||.:..:..:|.:| |.:|
  Fly   243 ITNKRCQRPSVFTDVMSHIEFIRRIFLTQN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cma1NP_037224.1 Tryp_SPc 21..240 CDD:214473 72/247 (29%)
Tryp_SPc 22..243 CDD:238113 73/249 (29%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 72/247 (29%)
Tryp_SPc 43..267 CDD:238113 73/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.