DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krt8 and LamC

DIOPT Version :9

Sequence 1:NP_955402.1 Gene:Krt8 / 25626 RGDID:2984 Length:483 Species:Rattus norvegicus
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:515 Identity:137/515 - (26%)
Similarity:229/515 - (44%) Gaps:114/515 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat    22 SRSFTSGPGARISSSSFSRVGSSSSSFRGSLGGFGGAGVGGITAVTVNQSLLNPLKLEVDPNIQA 86
            ||:.||.|....|:|  ||||::|.:                          :|.:..       
  Fly    13 SRASTSTPVGGASTS--SRVGATSPT--------------------------SPTRTS------- 42

  Rat    87 VRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQ-KTSRSNMDNMFESYINNLRRQ 150
             |.||||:::.||::.|.:||::|.||.:|..|..:.:|.|.. ....||:..::|..:...|:.
  Fly    43 -RQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKL 106

  Rat   151 LEALGQEKLKLEVELGNMQGLVEDFK---------------------NKYEDEIN---------- 184
            |:...:||.|||:::..:....:|.|                     |:| :|:|          
  Fly   107 LDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRY-NEVNGKYNQSLADR 170

  Rat   185 -------KRTEMENEFVL-----IKKDVDEAYMNKVELESRLEGLTDEINFLRQIHEEEIRELQS 237
                   |...:|||.:.     ::|.::...:.:|:||::.:.|.:|:.|..|:|.:|:.|.:|
  Fly   171 KKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRS 235

  Rat   238 ----QISDTSVVLSMDNSRSLDMDSIIAEVRAQYEEIANRSRAEAETMYQIKYEELQTLAGKHGD 298
                :||:....||......|...  :.|:|.|||.....:|.|.|.:|..:.:.|:..|.:...
  Fly   236 RRQIEISEIDGRLSRQYEAKLQQS--LQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQ 298

  Rat   299 DLRRSKTEISEMNRNISRLQAEIDALKGQRATLEAAIADAEQRGELAVKDANAKLEDLKNALQKA 363
            ....:..|:..|...|..|.|::..|:...|.|.|.|.:.|...:...:..|..:..|:..||:.
  Fly   299 GSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRM 363

  Rat   364 KQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRL----------ESGMQNMSIHTKTTSG 418
            :.:||.||:|||.||::|::||:|||.|.|||.|||.||          :||:.:...|...:  
  Fly   364 RDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTAS-- 426

  Rat   419 YAGGLSSSYGGLTSPGFSYGMSSFQPGFGSVGGSSTYSRTKAVVVKKIETRDGKLVSESS 478
                 :||..|..:|.   |..|..||   :.|||...|.:.|    |:..:.:.:||.|
  Fly   427 -----ASSRSGRVTPS---GRRSATPG---ISGSSAVKRRRTV----IDESEDRTLSEYS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Krt8NP_955402.1 Head 1..90 14/67 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 10/20 (50%)
Keratin_2_head <63..87 CDD:292825 1/23 (4%)
Filament 90..401 CDD:278467 101/358 (28%)
Coil 1A 91..126 13/34 (38%)
Linker 1 127..143 4/16 (25%)
Coil 1B 144..235 27/133 (20%)
Linker 12 236..259 6/26 (23%)
Coil 2 260..398 45/137 (33%)
Necessary for interaction with PNN. /evidence=ECO:0000250 261..382 35/120 (29%)
DUF2570 282..>358 CDD:305162 16/75 (21%)
Tail 399..483 23/90 (26%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 101/358 (28%)
ATP-synt_B <67..>142 CDD:304375 18/74 (24%)
MreC <178..>224 CDD:302802 11/45 (24%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.