DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cd81 and Tsp42Er

DIOPT Version :9

Sequence 1:NP_037219.2 Gene:Cd81 / 25621 RGDID:2315 Length:236 Species:Rattus norvegicus
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:224 Identity:61/224 - (27%)
Similarity:99/224 - (44%) Gaps:50/224 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat    10 IKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTSLLYLELGDKPAP-STFYVGIYILIAVGAVMM 73
            |:||.|:|||:.     .:||:|         |.::.:...|:.|| ....:|:|  ||||:::.
  Fly     8 IRYLAFLFNFLC-----AVLGIA---------TIVVNVIAIDQIAPKDQLILGLY--IAVGSIVF 56

  Rat    74 FVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFV-----NKDQIAKDVKQFYDQALQQ 133
            .:.|.||:|||:||.|:...:.|.::::....:   :..||     .:|.|.| :||.:  |.|.
  Fly    57 LLSFFGCFGAIKESICVTWAYATSMLVMLIVSI---VMLFVFRMHFEEDSITK-LKQAF--AKQT 115

  Rat   134 AVMDDDANNAKAVVKTFHETLNCCGSNTLTTLTTTVLRNSLCPSSSNSFTQL-LKEDCHQKI--- 194
            ...|     |.|..:|.::   |||...|.......:   ..|||....... .::.|..|:   
  Fly   116 NTFD-----AMAEYQTQYQ---CCGIYKLKDYGDAYI---TVPSSCYDQNDTPYRDGCLAKMETQ 169

  Rat   195 -DELFSG------KLYLIGIAAIVVAVIM 216
             :||..|      .|.:|.|.|...:.||
  Fly   170 YEELLKGPKIVGWMLMVIEIGAFTFSTIM 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cd81NP_037219.2 Tetraspannin 10..226 CDD:395265 61/224 (27%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 59/219 (27%)
tetraspanin_LEL 93..174 CDD:239401 23/94 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.