DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABRB3 and Rdl

DIOPT Version :9

Sequence 1:NP_000805.1 Gene:GABRB3 / 2562 HGNCID:4083 Length:473 Species:Homo sapiens
Sequence 2:NP_001261617.1 Gene:Rdl / 39054 FlyBaseID:FBgn0004244 Length:608 Species:Drosophila melanogaster


Alignment Length:548 Identity:181/548 - (33%)
Similarity:273/548 - (49%) Gaps:124/548 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    37 VKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSG 101
            :...:|.....||.|:||::|||||.||:.:.:.||..:|||.||:||..||:|:|.|.||||..
  Fly    59 ISAILDSFSVSYDKRVRPNYGGPPVEVGVTMYVLSISSLSEVKMDFTLDFYFRQFWTDPRLAYRK 123

Human   102 IP--LNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMD 164
            .|  ..|::.:.....:|||||:|:|:|:|:.|..|..|..||:|..|::...:|:|.||:|.|:
  Fly   124 RPGVETLSVGSEFIKNIWVPDTFFVNEKQSYFHIATTSNEFIRVHHSGSITRSIRLTITASCPMN 188

Human   165 LRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGA 229
            |:.:|:|.|.|.:||||:|||..||.::||.|..:|.....:|||||.::.||..:..:...||.
  Fly   189 LQYFPMDRQLCHIEIESFGYTMRDIRYFWRDGLSSVGMSSEVELPQFRVLGHRQRATEINLTTGN 253

Human   230 YPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLR 294
            |.||:...:..|::||:::|.|:||.||.|:||||||:|.:|:.||||||:||||||||:.:...
  Fly   254 YSRLACEIQFVRSMGYYLIQIYIPSGLIVIISWVSFWLNRNATPARVALGVTTVLTMTTLMSSTN 318

Human   295 ETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQK-----KLAEKTAKAKNDRS 354
            ..||||.|||:||:||..|||.||.:|||||.|.|:......::|:     |:||:..:..:..:
  Fly   319 AALPKISYVKSIDVYLGTCFVMVFASLLEYATVGYMAKRIQMRKQRFMAIQKIAEQKKQQLDGAN 383

Human   355 KSESN---------------------------------------------RVDAHGN-------- 366
            :.::|                                             ...:||:        
  Fly   384 QQQANPNPNANVGGPGGVGVGPGGPGGPGGGVNVGVGMGMGPEHGHGHGHHAHSHGHPHAPKQTV 448

Human   367 ----ILLTSLE---------------------VHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQS 406
                |..::::                     ||:......||   |..:.::....|.|.....
  Fly   449 SNRPIGFSNIQQNVGTRGCSIVGPLFQEVRFKVHDPKAHSKGG---TLENTVNGGRGGPQSHGPG 510

Human   407 M------------------PREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNA------ 447
            .                  |.||.|.  .:.::|   .||.......|:|     |:|.      
  Fly   511 PGQGGGPPGGGGGGGGGGGPPEGGGD--PEAAVP---AHLLHPGKVKKVK-----DINKLLGITP 565

Human   448 --IDRWSRIVFPFTFSLFNLVYWLYYVN 473
              ||::||||||..|..|||:||:.|::
  Fly   566 SDIDKYSRIVFPVCFVCFNLMYWIIYLH 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABRB3NP_000805.1 LIC 10..471 CDD:273305 180/544 (33%)
Benzamidine binding, agonist. /evidence=ECO:0000269|PubMed:24909990 120..122 1/1 (100%)
Benzamidine binding, agonist. /evidence=ECO:0000269|PubMed:24909990, ECO:0007744|PDB:4COF 180..182 1/1 (100%)
RdlNP_001261617.1 LGIC_ECD_GABAR_RDL-like 83..266 CDD:349809 75/182 (41%)
Neur_chan_memb 274..588 CDD:397193 89/326 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D226476at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101786
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.