DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdc2 and Sdc

DIOPT Version :9

Sequence 1:NP_037214.1 Gene:Sdc2 / 25615 RGDID:3649 Length:211 Species:Rattus norvegicus
Sequence 2:NP_001163238.2 Gene:Sdc / 37447 FlyBaseID:FBgn0010415 Length:495 Species:Drosophila melanogaster


Alignment Length:196 Identity:58/196 - (29%)
Similarity:89/196 - (45%) Gaps:39/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Rat    37 DKDMYLDS------------SSIEEASGLYPIDDD-DYSSASGSGAYEDKGSPDLTTSQLIPRI- 87
            ||::.:|.            :::|  :|..|..|: |..    .|..:|.|..|:..    ||| 
  Fly   318 DKEIDIDGPEPGHLPPVVHHNTVE--TGHIPTTDEIDVD----GGDEDDNGDSDIDG----PRIG 372

  Rat    88 ----SLTSAAPEVETMTLKTQSITPTQTESPEETDKKEFEISEAEEKQDPAVKSTDVYTEKHSDN 148
                .:|...|......:  ..:.|....:.:.:|.|  .|.......:..:.|.|    ..:.:
  Fly   373 GNDGDITERGPGAGGSNV--HELDPNTNVNSQPSDTK--GIDHRPNGNEVVIMSED----DRTSS 429

  Rat   149 LFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGE--RKPSSAAYQK-APTKEFY 210
            .|.:..:|||||.|.|:|.|.||.:::.:||||||||||||.|.|  |.|::.:|.| |..:|||
  Fly   430 FFSQPGILAAVIGGAVVGLLCAILVVMFIVYRMRKKDEGSYALDEPKRSPANNSYAKNANNREFY 494

  Rat   211 A 211
            |
  Fly   495 A 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdc2NP_037214.1 Syndecan 148..209 CDD:279386 31/63 (49%)
SdcNP_001163238.2 Syndecan 429..493 CDD:279386 31/63 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335894
Domainoid 1 1.000 62 1.000 Domainoid score I10057
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003556
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10915
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.