DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppp1cb and Pp1-13C

DIOPT Version :9

Sequence 1:NP_037197.1 Gene:Ppp1cb / 25594 RGDID:3376 Length:327 Species:Rattus norvegicus
Sequence 2:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster


Alignment Length:298 Identity:265/298 - (88%)
Similarity:280/298 - (93%) Gaps:0/298 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat     6 LNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTD 70
            ||::|:|:|||||||.||||.||::|.|:||||:|||||.|:|||||||||||||||||||||.|
  Fly     5 LNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYD 69

  Rat    71 LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 135
            |||||||||:|||||||||||||||||||||||||||||||||.|||||||||||||||||||||
  Fly    70 LLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGF 134

  Rat   136 YDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLL 200
            |||||||:.|||||||||||||||:.||||||||||||||||||.||||||||||||||||.|||
  Fly   135 YDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLL 199

  Rat   201 CDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTL 265
            |||||||||||..|||||||||||||||:||.|||.:||||||||||||||||||||||||||||
  Fly   200 CDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTL 264

  Rat   266 FSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAK 303
            ||||||||||||||.|||||.|||||||||||.||:.|
  Fly   265 FSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKRKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppp1cbNP_037197.1 MPP_PP1_PPKL 7..297 CDD:277359 259/289 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 262/293 (89%)
MPP_PP1_PPKL 6..296 CDD:277359 259/289 (90%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.