DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Id3 and emc

DIOPT Version :9

Sequence 1:NP_037190.1 Gene:Id3 / 25585 RGDID:2860 Length:119 Species:Rattus norvegicus
Sequence 2:NP_523876.2 Gene:emc / 38091 FlyBaseID:FBgn0000575 Length:199 Species:Drosophila melanogaster


Alignment Length:90 Identity:32/90 - (35%)
Similarity:47/90 - (52%) Gaps:15/90 - (16%)


- Green bases have known domain annotations that are detailed below.


  Rat    28 RGKSPSAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVL-AEPAPGP 91
            ||...:||..:.|        |:|::|||.:|:..:|:::||:|.|||||.|||..| ..|..|.
  Fly    31 RGDGENAEMKMYL--------SKLKDLVPFMPKNRKLTKLEIIQHVIDYICDLQTELETHPEMGN 87

  Rat    92 PDGPHLPIQTAELTPELVISKDKRS 116
            .|.      .|.||....:.:|:.|
  Fly    88 FDA------AAALTAVNGLHEDEDS 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Id3NP_037190.1 bHLH_dnHLH_ID3 23..83 CDD:381536 23/54 (43%)
emcNP_523876.2 HLH <37..80 CDD:238036 21/50 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337663
Domainoid 1 1.000 55 1.000 Domainoid score I10836
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624054at2759
OrthoFinder 1 1.000 - - FOG0000920
OrthoInspector 1 1.000 - - otm45490
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11723
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.910

Return to query results.
Submit another query.