DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ywhaz and 14-3-3epsilon

DIOPT Version :9

Sequence 1:NP_037143.2 Gene:Ywhaz / 25578 RGDID:3980 Length:245 Species:Rattus norvegicus
Sequence 2:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster


Alignment Length:245 Identity:164/245 - (66%)
Similarity:197/245 - (80%) Gaps:4/245 - (1%)


- Green bases have known domain annotations that are detailed below.


  Rat     2 DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIE 66
            ::...|.||||||||||||:|...||.|.....||:.|||||||||||||:||||:|||:::|||
  Fly     3 ERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIE 67

  Rat    67 QKTE--GAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYL 129
            ||.|  |||:|.:|.:.||.::|.||||||:|:|::|||.|||.|:..||||||.||||||:|||
  Fly    68 QKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYL 132

  Rat   130 AEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKT 194
            ||.|.|.|:|...:.|..||:.|.:|:..::.||||||||||||||||||||||||::||.|||.
  Fly   133 AEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKA 197

  Rat   195 AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAE--AGEG 242
            |||:|||||||||||||||||||||||||||||||||.|.:|.:  ||:|
  Fly   198 AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YwhazNP_037143.2 14-3-3_beta_zeta 2..230 CDD:206758 156/229 (68%)
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 156/228 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100283
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X206
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.