DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ywhaq and 14-3-3epsilon

DIOPT Version :9

Sequence 1:NP_037185.1 Gene:Ywhaq / 25577 RGDID:3979 Length:245 Species:Rattus norvegicus
Sequence 2:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster


Alignment Length:243 Identity:159/243 - (65%)
Similarity:190/243 - (78%) Gaps:2/243 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat     2 EKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIE 66
            |:...:.||||||||||||:|...||.|.....||:.|||||||||||||:|.||::||:|:|||
  Fly     3 ERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIE 67

  Rat    67 QKTDT--SDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYL 129
            ||.:.  :::||::||.||.:||.|||.||:.:|.:|:|:||..||:.||||||.||||||.|||
  Fly    68 QKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYL 132

  Rat   130 AEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKT 194
            ||.|.|.|||...|||..||:.|.||:..::.||||||||||||||||||||||:|:.||.|||.
  Fly   133 AEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKA 197

  Rat   195 AFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEG 242
            |||:||||||||:|:||||||||||||||||||||||...||.|...|
  Fly   198 AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YwhaqNP_037185.1 14-3-3_theta 1..234 CDD:206759 155/233 (67%)
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 151/228 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.