DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ywhah and 14-3-3zeta

DIOPT Version :9

Sequence 1:NP_037184.1 Gene:Ywhah / 25576 RGDID:3978 Length:246 Species:Rattus norvegicus
Sequence 2:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster


Alignment Length:240 Identity:176/240 - (73%)
Similarity:208/240 - (86%) Gaps:4/240 - (1%)


- Green bases have known domain annotations that are detailed below.


  Rat     3 DREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIE 67
            |:|:|:|:|:||||:|||||||.|||:|||....||||:||||||||||||||||||||||||||
  Fly     5 DKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIE 69

  Rat    68 QKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYR 132
            |||.|...:::|  .:.|||::||||..:|.:||.||||:||...::  .|||||||||||||||
  Fly    70 QKTEASARKQQL--AREYRERVEKELREICYEVLGLLDKYLIPKASN--PESKVFYLKMKGDYYR 130

  Rat   133 YLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLA 197
            ||||||:|:.:|:||:.|:.||::||:|||..||||||||||||||||||||||.|:|::||.||
  Fly   131 YLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLA 195

  Rat   198 KQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEA 242
            |||||||||||||||||||||||||||||||||||||||.|.:||
  Fly   196 KQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YwhahNP_037184.1 14-3-3_eta 3..241 CDD:206761 174/237 (73%)
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 171/232 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18860
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.