DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABRA2 and GluClalpha

DIOPT Version :9

Sequence 1:NP_001317619.1 Gene:GABRA2 / 2555 HGNCID:4076 Length:511 Species:Homo sapiens
Sequence 2:NP_001287408.1 Gene:GluClalpha / 42350 FlyBaseID:FBgn0024963 Length:463 Species:Drosophila melanogaster


Alignment Length:510 Identity:176/510 - (34%)
Similarity:258/510 - (50%) Gaps:83/510 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    20 WDPARLVLANIQEDEAKNNITIFTR-----ILDRLLDG--YDNRLRP-GLG--DSITEVFTNIYV 74
            |  |.|..|::......||..|..|     :||::|..  ||.|:|| |:.  |....|..||:|
  Fly     8 W--AILYFASLCSASLANNAKINFREKEKKVLDQILGAGKYDARIRPSGINGTDGPAVVRVNIFV 70

Human    75 TSFGPVSDTDMEYTIDVFFRQKWKDERLKF---KGPMNILRLNNLMASKIWTPDTFFHNGKKSVA 136
            .|...:.|..|||::.:.||::|.||||||   :|.:..|.|..  |:::|.||.||.|.|:...
  Fly    71 RSISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKYLTLTE--ANRVWMPDLFFSNEKEGHF 133

Human   137 HNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYN 201
            ||:.|||..:||..:|::||::|:::...|||:|:.:|:|...|.|:..||.:||:::.::|  .
  Fly   134 HNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLW--K 196

Human   202 ASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVI 266
            ..|.|||..: ..|.::.|..........|::||||:.:......||:..|::||.|:||.|.||
  Fly   197 EGDPVQVVKN-LHLPRFTLEKFLTDYCNSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVI 260

Human   267 LSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEF 331
            :|.|||||::.:||||...||||:|||.|.:.....|||.|:|..|:|.:..||..|||.||:||
  Fly   261 VSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEF 325

Human   332 ATVNYFTKRGWAWDGKSVVNDKSPSIKAEGITLTYNSVKAILQGAKLIWSKYIAFSWPSLF---- 392
            |.|||.::     .|.:..|....::|.:...|...|:.|  ....|.......|:..|.|    
  Fly   326 ALVNYASR-----SGSNKANMHKENMKKKRRDLEQASLDA--ASDLLDTDSNATFAMASQFARGG 383

Human   393 -QEKTLE-------YLEKWMDCLTFKQSSKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISK 449
             |:|.|.       .|||.:.|....|:.|:                    ||..|    :.:||
  Fly   384 GQQKPLVRHPGDPLALEKRLQCEVHMQAPKR--------------------PNCCK----TWLSK 424

Human   450 SATTPEPNKKPENKPAEAKKTFNSVSKIDRMSRIVFPVLFGTFNLVYWATYLNRE 504
            .             |..:|       :||.:|||.||::|..||||||:|||.||
  Fly   425 F-------------PTRSK-------RIDVISRITFPLVFALFNLVYWSTYLFRE 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABRA2NP_001317619.1 LIC 25..500 CDD:273305 169/499 (34%)
LGIC_ECD_GABAAR_A2 47..249 CDD:349836 74/209 (35%)
GluClalphaNP_001287408.1 LIC 3..455 CDD:273305 171/504 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.