DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4a and Rab11

DIOPT Version :9

Sequence 1:NP_037151.2 Gene:Rab4a / 25532 RGDID:3529 Length:218 Species:Rattus norvegicus
Sequence 2:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster


Alignment Length:201 Identity:96/201 - (47%)
Similarity:122/201 - (60%) Gaps:19/201 - (9%)


- Green bases have known domain annotations that are detailed below.


  Rat     5 AMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDT 69
            |..:.||:|||.::||::|.|||.||.:|...:|..:|..||||||.::.|.|.||.:|.|||||
  Fly     3 AREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDT 67

  Rat    70 AGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADR 134
            |||||:|::|.:|||||.||||||||....||..:..||.:.|..|.|||||:|.|||.||...|
  Fly    68 AGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLR 132

  Rat   135 EVTFLEASRFAQENELMFLETSALTGENVEEAFMQCARKILNKIESGELDPERMGSGIQYGDAAL 199
            .|...||..||:.|.|.|:|||||...|||.||    :.||.:|               |...:.
  Fly   133 SVPTDEAKLFAERNGLSFIETSALDSTNVETAF----QNILTEI---------------YRIVSQ 178

  Rat   200 RQLRSP 205
            :|:|.|
  Fly   179 KQIRDP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4aNP_037151.2 Rab4 14..174 CDD:206696 85/159 (53%)
Effector region. /evidence=ECO:0000250 42..50 5/7 (71%)
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 90/182 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.