Sequence 1: | NP_001184226.1 | Gene: | GABPA / 2551 | HGNCID: | 4071 | Length: | 454 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524461.2 | Gene: | pnt / 42757 | FlyBaseID: | FBgn0003118 | Length: | 718 | Species: | Drosophila melanogaster |
Alignment Length: | 596 | Identity: | 128/596 - (21%) |
---|---|---|---|
Similarity: | 181/596 - (30%) | Gaps: | 318/596 - (53%) |
- Green bases have known domain annotations that are detailed below.
Human 137 LVEEAQVI----TLDGTKHITTISD----ETSEQVTR----------------WAAALEGYRKEQ 177
Human 178 ERLGIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTL-NISGRELCSLNQEDFFQRVP--RGEI 239
Human 240 LWSHLELLRK---------------------YVLASQEQ---------------QMNEIVTID-- 266
Human 267 -------------------------------------------QPV-------------QIIPAS 275
Human 276 VQSA----TPTTIKVINSSAK-----------------------------AAKV----------- 296
Human 297 --------------QRAP----------------------------------------RISGED- 306
Human 307 ---RSSPGN--------RTGN-------------------------------------------- 316
Human 317 -------------------------------------------NGQIQLWQFLLELLTDKDARDC 338
Human 339 ISWVGDEGEFKLNQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDL 403
Human 404 KTLIGYSAAEL 414 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GABPA | NP_001184226.1 | GABP-alpha | 40..119 | CDD:402975 | |
SAM_PNT-GABP-alpha | 168..254 | CDD:176084 | 29/109 (27%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 297..316 | 10/70 (14%) | |||
ETS | 319..403 | CDD:197710 | 56/83 (67%) | ||
pnt | NP_524461.2 | SAM_PNT-ETS-1,2 | 179..250 | CDD:188879 | 24/70 (34%) |
ETS | 609..693 | CDD:197710 | 56/83 (67%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3806 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D243757at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |