DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPA and pnt

DIOPT Version :9

Sequence 1:NP_001184226.1 Gene:GABPA / 2551 HGNCID:4071 Length:454 Species:Homo sapiens
Sequence 2:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster


Alignment Length:596 Identity:128/596 - (21%)
Similarity:181/596 - (30%) Gaps:318/596 - (53%)


- Green bases have known domain annotations that are detailed below.


Human   137 LVEEAQVI----TLDGTKHITTISD----ETSEQVTR----------------WAAALEGYRKEQ 177
            |||...:.    .:.|.|.:.::||    |.|.:|..                ..|:...:.||.
  Fly   109 LVESKNIFIKEEPIHGCKDLCSLSDISDHEASLEVPTALPPLTPGTNRKVNEVLKASFASWEKEV 173

Human   178 ERLGIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTL-NISGRELCSLNQEDFFQRVP--RGEI 239
            ::..|..||.:|:.:.|::|:.|...|||:..::|... .:.||.:..|.:|.|....|  .|:|
  Fly   174 QKCNITKDPREWTEEHVIYWLNWAKNEFSLVSMNLDPFYKMKGRAMVDLGKEKFLAITPPFTGDI 238

Human   240 LWSHLELLRK---------------------YVLASQEQ---------------QMNEIVTID-- 266
            ||.||::|:|                     .|..|..|               .:|..:::|  
  Fly   239 LWEHLDILQKDCEKPNEDIVHGNSFESATTASVCGSDHQVANYPNETHANSNNSSINSRLSMDYV 303

Human   267 -------------------------------------------QPV-------------QIIPAS 275
                                                       ||.             .::|.:
  Fly   304 TSAGNSDNKNFHRATPHSHNGYNTSNTHDRINNSTPPQQQQSQQPTVNGSGSASSNNNNSMLPPA 368

Human   276 VQSA----TPTTIKVINSSAK-----------------------------AAKV----------- 296
            ||.:    ..|:....|:|:.                             ||.:           
  Fly   369 VQQSNNENNNTSSSNTNNSSNNNNNSGGSNNSNAGSNNNNNNNNNINFMAAAAIFQHHLKEEPGT 433

Human   297 --------------QRAP----------------------------------------RISGED- 306
                          |..|                                        .||.:| 
  Fly   434 QNGNIGGYGGGSNSQNDPTDLSSYGLPAHLAAYGGGSGSGPTGGRSSGGGGDESDYHSTISAQDH 498

Human   307 ---RSSPGN--------RTGN-------------------------------------------- 316
               :||.||        .|||                                            
  Fly   499 QSQQSSGGNGSGGASGGSTGNSNGYLDSSSEFYGSYAGRNRFHDGYPPEFTPYDAQSFQSMGPQP 563

Human   317 -------------------------------------------NGQIQLWQFLLELLTDKDARDC 338
                                                       :|.|||||||||||.||..:..
  Fly   564 TAMDQWGAAHAHQHPAAYMSTLGLDKGLLGGYTTQGGVPCFTGSGPIQLWQFLLELLLDKTCQSF 628

Human   339 ISWVGDEGEFKLNQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDL 403
            |||.||..||||..|:.||::||.|||||.||||||||.||||||.::|.|..|||:||:|||||
  Fly   629 ISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDL 693

Human   404 KTLIGYSAAEL 414
            :.|:|::..||
  Fly   694 QNLVGHTPEEL 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPANP_001184226.1 GABP-alpha 40..119 CDD:402975
SAM_PNT-GABP-alpha 168..254 CDD:176084 29/109 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..316 10/70 (14%)
ETS 319..403 CDD:197710 56/83 (67%)
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879 24/70 (34%)
ETS 609..693 CDD:197710 56/83 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.